• Gene id: 8771

Gene Summary

• Gene Symbol: TNFRSF6B   Gene   UCSC   Ensembl
• Aliases: DCR3, DJ583P15.1.1, M68, M68E, TR6
• Gene name: TNF receptor superfamily member 6b
• Alternate names: tumor necrosis factor receptor superfamily member 6B, decoy receptor 3 variant 1, decoy receptor 3 variant 2, decoy receptor for Fas ligand, tumor necrosis factor receptor superfamily, member 6b, decoy,
• Gene location: 20q13.33 (63696651: 63698683)     Exons: 7     NC_000020.11
• Gene summary(Entrez): This gene belongs to the tumor necrosis factor receptor superfamily. The encoded protein is postulated to play a regulatory role in suppressing FasL- and LIGHT-mediated cell death. It acts as a decoy receptor that competes with death receptors for ligand
• OMIM: 603361

Protein Summary

• Protein general information: O95407  
  • Name: Tumor necrosis factor receptor superfamily member 6B (Decoy receptor 3) (DcR3) (Decoy receptor for Fas ligand) (M68)
  • Length: 300  
  • Mass: 32680
  • Tissue specificity: Detected in fetal lung, brain and liver. Detected in adult stomach, spinal cord, lymph node, trachea, spleen, colon and lung. Highly expressed in several primary tumors from colon, stomach, rectum, esophagus and in SW480 colon carcinom
• Sequence:

  MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDSPTTCGPCPP
  RHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFFAHAGFCLEHASCPPGAGVIAPGTPSQNTQC
  QPCPPGTFSASSSSSEQCQPHRNCTALGLALNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDIS
  IKRLQRLLQALEAPEGWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH

• Structural information:
  • Interpro: IPR001368  IPR034023  
  • Prosite: PS00652 PS50050
  • CDD: cd10575
  • PDB: 3K51 3MHD 3MI8 4J6G 4KGG 4KGQ 4MSV 5L36
  • PDBsum: 3K51 3MHD 3MI8 4J6G 4KGG 4KGQ 4MSV 5L36
  • STRING: ENSP00000480348
• Other Databases: GeneCards:  TNFRSF6B  Malacards:  TNFRSF6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq