• Gene id: 8767

Gene Summary

• Gene Symbol: RIPK2   Gene   UCSC   Ensembl
• Aliases: CARD3, CARDIAK, CCK, GIG30, RICK, RIP2
• Gene name: receptor interacting serine/threonine kinase 2
• Alternate names: receptor-interacting serine/threonine-protein kinase 2, CARD-carrying kinase, CARD-containing IL-1 beta ICE-kinase, CARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinase, RIP-2, growth-inhibiting gene 30, receptor-interacting protein (RIP,
• Gene location: 8q21.3 (89757815: 89791063)     Exons: 12     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both
• OMIM: 603455

Protein Summary

• Protein general information: O43353  
  • Name: Receptor interacting serine/threonine protein kinase 2 (EC 2.7.11.1) (CARD containing interleukin 1 beta converting enzyme associated kinase) (CARD containing IL 1 beta ICE kinase) (RIP like interacting CLARP kinase) (Receptor interacting protein 2) (RIP
  • Length: 540  
  • Mass: 61195
  • Tissue specificity: Detected in heart, brain, placenta, lung, peripheral blood leukocytes, spleen, kidney, testis, prostate, pancreas and lymph node.
• Sequence:

  MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARF
  SYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQ
  NILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSR
  KQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
  TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSR
  KAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQ
  MTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILV
  VSRSPSLNLLQNKSM

• Structural information:
  • Protein Domains: (18..29-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (432..52-)
    (/note="CARD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00046"-)
  • Interpro: IPR001315  IPR042149  IPR011029  IPR011009  IPR000719   IPR017322  IPR001245  IPR008271  
  • Prosite: PS50209 PS50011 PS00108
  • CDD: cd08786
  • PDB: 2N7Z 2N83 4C8B 5AR2 5AR3 5AR4 5AR5 5AR7 5AR8 5J79 5J7B 5NG0 5NG2 5NG3 5W5J 5W5O 5YRN 6ES0 6FU5 6GFJ 6GGS 6HMX 6RN8 6RNA 6S1F 6SZE 6SZJ 6UL8
  • PDBsum: 2N7Z 2N83 4C8B 5AR2 5AR3 5AR4 5AR5 5AR7 5AR8 5J79 5J7B 5NG0 5NG2 5NG3 5W5J 5W5O 5YRN 6ES0 6FU5 6GFJ 6GGS 6HMX 6RN8 6RNA 6S1F 6SZE 6SZJ 6UL8
  • DIP: 27518
  • STRING: ENSP00000220751
• Other Databases: GeneCards:  RIPK2  Malacards:  RIPK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002250	adaptive immune response	IBA	biological process
GO:0004672	protein kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0045087	innate immune response	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0071225	cellular response to muramyl dipeptide	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0005856	cytoskeleton	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050852	T cell receptor signaling pathway	ISS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002250	adaptive immune response	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0050700	CARD domain binding	IDA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0034134	toll-like receptor 2 signaling pathway	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007254	JNK cascade	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002827	positive regulation of T-helper 1 type immune response	IEA	biological process
GO:0032722	positive regulation of chemokine production	IEA	biological process
GO:0032743	positive regulation of interleukin-2 production	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IEA	biological process
GO:0033091	positive regulation of immature T cell proliferation	IEA	biological process
GO:0042098	T cell proliferation	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046641	positive regulation of alpha-beta T cell proliferation	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0070427	nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA	biological process
GO:0070555	response to interleukin-1	IEA	biological process
GO:0070671	response to interleukin-12	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0034142	toll-like receptor 4 signaling pathway	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0045627	positive regulation of T-helper 1 cell differentiation	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA	biological process
GO:0070673	response to interleukin-18	IEA	biological process
GO:0071223	cellular response to lipoteichoic acid	IEA	biological process
GO:0071224	cellular response to peptidoglycan	IEA	biological process
GO:1904417	positive regulation of xenophagy	IEA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031398	positive regulation of protein ubiquitination	NAS	biological process
GO:0032727	positive regulation of interferon-alpha production	NAS	biological process
GO:0032728	positive regulation of interferon-beta production	NAS	biological process
GO:0032735	positive regulation of interleukin-12 production	NAS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	NAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0031398	positive regulation of protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0032092	positive regulation of protein binding	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0050700	CARD domain binding	IPI	molecular function
GO:0030274	LIM domain binding	IPI	molecular function
GO:0032991	protein-containing complex	IMP	cellular component
GO:0089720	caspase binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa05132	Salmonella infection
hsa04621	NOD-like receptor signaling pathway
hsa05152	Tuberculosis
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881