• Gene id: 8766

Gene Summary

• Gene Symbol: RAB11A   Gene   UCSC   Ensembl
• Aliases: YL8
• Gene name: RAB11A, member RAS oncogene family
• Alternate names: ras-related protein Rab-11A, RAB 11A, member oncogene family, rab-11,
• Gene location: 15q22.31 (157138925: 157269369)     Exons: 24     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isof
• OMIM: 605570

Protein Summary

• Protein general information: P62491  
  • Name: Ras related protein Rab 11A (Rab 11) (YL8)
  • Length: 216  
  • Mass: 24394
• Sequence:

  MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRA
  ITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSF
  IETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • PDB: 1OIV 1OIW 1OIX 1YZK 2D7C 2GZD 2GZH 2HV8 4C4P 4D0L 4D0M 4LWZ 4LX0 4UJ3 4UJ4 4UJ5 5C46 5C4G 5EUQ 5EZ5 5FBL 5FBQ 5FBR 5FBV 5FBW 5JCZ 6DJL 6IXV
  • PDBsum: 1OIV 1OIW 1OIX 1YZK 2D7C 2GZD 2GZH 2HV8 4C4P 4D0L 4D0M 4LWZ 4LX0 4UJ3 4UJ4 4UJ5 5C46 5C4G 5EUQ 5EZ5 5FBL 5FBQ 5FBR 5FBV 5FBW 5JCZ 6DJL 6IXV
  • DIP: 29138
  • STRING: ENSP00000261890
• Other Databases: GeneCards:  RAB11A  Malacards:  RAB11A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150093	amyloid-beta clearance by transcytosis	IGI	biological process
GO:0005813	centrosome	IDA	colocalizes with
GO:0098837	postsynaptic recycling endosome	IBA	cellular component
GO:0055037	recycling endosome	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0032402	melanosome transport	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IBA	biological process
GO:0030133	transport vesicle	IBA	cellular component
GO:0006887	exocytosis	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:0055037	recycling endosome	ISS	cellular component
GO:0032402	melanosome transport	ISS	biological process
GO:0031175	neuron projection development	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003091	renal water homeostasis	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0055037	recycling endosome	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0098837	postsynaptic recycling endosome	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0032402	melanosome transport	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0051223	regulation of protein transport	IEA	biological process
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IEA	biological process
GO:0099003	vesicle-mediated transport in synapse	IEA	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016192	vesicle-mediated transport	IDA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:0055037	recycling endosome	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005771	multivesicular body	IDA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0016192	vesicle-mediated transport	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005828	kinetochore microtubule	IDA	colocalizes with
GO:0000922	spindle pole	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0072594	establishment of protein localization to organelle	IMP	biological process
GO:0048227	plasma membrane to endosome transport	NAS	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0060627	regulation of vesicle-mediated transport	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019905	syntaxin binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030953	astral microtubule organization	IMP	biological process
GO:0036258	multivesicular body assembly	IMP	biological process
GO:0010796	regulation of multivesicular body size	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0090307	mitotic spindle assembly	IMP	biological process
GO:0051650	establishment of vesicle localization	IMP	biological process
GO:0090150	establishment of protein localization to membrane	IMP	biological process
GO:0031489	myosin V binding	IPI	molecular function
GO:1990182	exosomal secretion	IMP	biological process
GO:0005794	Golgi apparatus	HDA	cellular component
GO:0098837	postsynaptic recycling endosome	IMP	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098837	postsynaptic recycling endosome	IDA	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05164	Influenza A
hsa04972	Pancreatic secretion
hsa04961	Endocrine and other factor-regulated calcium reabsorption
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881