• Gene id: 8764

Gene Summary

• Gene Symbol: TNFRSF14   Gene   UCSC   Ensembl
• Aliases: ATAR, CD270, HVEA, HVEM, LIGHTR, TR2
• Gene name: TNF receptor superfamily member 14
• Alternate names: tumor necrosis factor receptor superfamily member 14, CD40-like protein, herpes virus entry mediator A, tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator), tumor necrosis factor receptor-like gene2,
• Gene location: 1p36.32 (2556364: 2565621)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral e
• OMIM: 600556

Protein Summary

• Protein general information: Q92956  
  • Name: Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor like 2) (TR2) (CD antigen CD270)
  • Length: 283  
  • Mass: 30392
  • Tissue specificity: Widely expressed, with the highest expression in lung, spleen and thymus. Expressed in a subpopulation of B cells and monocytes (PubMed
• Sequence:

  MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVC
  EPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRV
  QKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICV
  KRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH

• Structural information:
  • Interpro: IPR001368  IPR022332  IPR034031  
  • Prosite: PS00652 PS50050
  • CDD: cd10582
  • PDB: 1JMA 2AW2 4FHQ 4RSU 5T2Q 5T2R 6NG3
  • PDBsum: 1JMA 2AW2 4FHQ 4RSU 5T2Q 5T2R 6NG3
  • DIP: 34779
  • STRING: ENSP00000347948
• Other Databases: GeneCards:  TNFRSF14  Malacards:  TNFRSF14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000406	positive regulation of T cell migration	IBA	biological process
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IBA	biological process
GO:0046642	negative regulation of alpha-beta T cell proliferation	IBA	biological process
GO:0002741	positive regulation of cytokine production involved in immune response	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0031295	T cell costimulation	IDA	biological process
GO:1905675	negative regulation of adaptive immune memory response	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019955	cytokine binding	IPI	molecular function
GO:2000406	positive regulation of T cell migration	IBA	biological process
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IBA	biological process
GO:0046642	negative regulation of alpha-beta T cell proliferation	IBA	biological process
GO:0002741	positive regulation of cytokine production involved in immune response	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0031295	T cell costimulation	IDA	biological process
GO:1905675	negative regulation of adaptive immune memory response	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019955	cytokine binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Arteriosclerosis	PMID:11742877
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881