• Gene id: 8761

Gene Summary

• Gene Symbol: PABPC4   Gene   UCSC   Ensembl
• Aliases: APP-1, APP1, PABP4, iPABP
• Gene name: poly(A) binding protein cytoplasmic 4
• Alternate names: polyadenylate-binding protein 4, PABP-4, activated-platelet protein 1, inducible poly(A)-binding protein, poly(A) binding protein, cytoplasmic 4 (inducible form), poly(A)-binding protein 4,
• Gene location: 1p34.3 (39576789: 39560815)     Exons: 16     NC_000001.11
• Gene summary(Entrez): Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 m

Protein Summary

• Protein general information: Q13310  
  • Name: Polyadenylate binding protein 4 (PABP 4) (Poly(A) binding protein 4) (Activated platelet protein 1) (APP 1) (Inducible poly(A) binding protein) (iPABP)
  • Length: 644  
  • Mass: 70783
  • Tissue specificity: Expressed at low levels in resting normal T cells; following T-cell activation, however, mRNA levels are rapidly up-regulated.
• Sequence:

  MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFD
  VIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEA
  ADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRD
  PNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
  LDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERK
  AHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMP
  SAIRQSGPRPTLRHLAPTGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAPRAVAPYKY
  ASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNS
  ELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS

• Structural information:
  • Protein Domains: (11..8-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (99..17-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (191..26-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (-)
  • Interpro: IPR012677  IPR036053  IPR006515  IPR002004  IPR035979   IPR000504  IPR003954  
  • Prosite: PS51309 PS50102
  • STRING: ENSP00000361949
• Other Databases: GeneCards:  PABPC4  Malacards:  PABPC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0010494	cytoplasmic stress granule	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0008266	poly(U) RNA binding	IBA	molecular function
GO:0008143	poly(A) binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0008143	poly(A) binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006396	RNA processing	TAS	biological process
GO:0006401	RNA catabolic process	TAS	biological process
GO:0006412	translation	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0017130	poly(C) RNA binding	IDA	NOT|molecular function
GO:0008266	poly(U) RNA binding	IDA	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0061515	myeloid cell development	IEA	biological process
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0003729	mRNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa03015	mRNA surveillance pathway
hsa03018	RNA degradation

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq