• Gene id: 8749

Gene Summary

• Gene Symbol: ADAM18   Gene   UCSC   Ensembl
• Aliases: ADAM27, tMDCIII
• Gene name: ADAM metallopeptidase domain 18
• Alternate names: disintegrin and metalloproteinase domain-containing protein 18, a disintegrin and metalloproteinase domain 18, transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein III,
• Gene location: 8p11.22 (39584567: 39730064)     Exons: 6     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes i

Protein Summary

• Protein general information: Q9Y3Q7  
  • Name: Disintegrin and metalloproteinase domain containing protein 18 (ADAM 18) (Transmembrane metalloproteinase like, disintegrin like, and cysteine rich protein III) (tMDC III)
  • Length: 739  
  • Mass: 82856
  • Tissue specificity: Expressed specifically in testis.
• Sequence:

  MFLLLALLTELGRLQAHEGSEGIFLHVTVPRKIKSNDSEVSERKMIYIITIDGQPYTLHLGKQSFLPQNFLVYTY
  NETGSLHSVSPYFMMHCHYQGYAAEFPNSFVTLSICSGLRGFLQFENISYGIEPVESSARFEHIIYQMKNNDPNV
  SILAVNYSHIWQKDQPYKVPLNSQIKNLSKLLPQYLEIYIIVEKALYDYMGSEMMAVTQKIVQVIGLVNTMFTQF
  KLTVILSSLELWSNENQISTSGDADDILQRFLAWKRDYLILRPHDIAYLLVYRKHPKYVGATFPGTVCNKSYDAG
  IAMYPDAIGLEGFSVIIAQLLGLNVGLTYDDITQCFCLRATCIMNHEAVSASGRKIFSNCSMHDYRYFVSKFETK
  CLQKLSNLQPLHQNQPVCGNGILESNEECDCGNKNECQFKKCCDYNTCKLKGSVKCGSGPCCTSKCELSIAGTPC
  RKSIDPECDFTEYCNGTSSNCVPDTYALNGRLCKLGTAYCYNGQCQTTDNQCAKIFGKGAQGAPFACFKEVNSLH
  ERSENCGFKNSQPLPCERKDVLCGKLACVQPHKNANKSDAQSTVYSYIQDHVCVSIATGSSMRSDGTDNAYVADG
  TMCGPEMYCVNKTCRKVHLMGYNCNATTKCKGKGICNNFGNCQCFPGHRPPDCKFQFGSPGGSIDDGNFQKSGDF
  YTEKGYNTHWNNWFILSFCIFLPFFIVFTTVIFKRNEISKSCNRENAEYNRNSSVVSESDDVGH

• Structural information:
  • Protein Domains: (184..38-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (390..47-)
    (/note="Disintegrin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00068-)
    (620..65-)
    (/note="EGF-like"-)
  • Interpro: IPR006586  IPR018358  IPR001762  IPR036436  IPR024079   IPR001590  IPR002870  IPR034027  
  • Prosite: PS50215 PS00427 PS50214
  • CDD: cd04269
  • STRING: ENSP00000265707
• Other Databases: GeneCards:  ADAM18  Malacards:  ADAM18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0007283	spermatogenesis	TAS	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R