• Gene id: 8740

Gene Summary

• Gene Symbol: TNFSF14   Gene   UCSC   Ensembl
• Aliases: CD258, HVEML, LIGHT, LTg
• Gene name: TNF superfamily member 14
• Alternate names: tumor necrosis factor ligand superfamily member 14, herpesvirus entry mediator ligand, tumor necrosis factor (ligand) superfamily, member 14, tumor necrosis factor ligand 1D, tumor necrosis factor superfamily member 14,
• Gene location: 19p13.3 (6670594: 6658125)     Exons: 6     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry media
• OMIM: 610815

Protein Summary

• Protein general information: O43557  
  • Name: Tumor necrosis factor ligand superfamily member 14 (Herpes virus entry mediator ligand) (HVEM L) (Herpesvirus entry mediator ligand) (CD antigen CD258) [Cleaved into: Tumor necrosis factor ligand superfamily member 14, membrane form; Tumor necrosis factor
  • Length: 240  
  • Mass: 26350
  • Tissue specificity: Predominantly expressed in the spleen but also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or
• Sequence:

  MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDG
  PAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLG
  GVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLV
  RLRDGTRSYFGAFMV

• Structural information:
  • Interpro: IPR006053  IPR006052  IPR008983  
  • Prosite: PS50049
  • CDD: cd00184
  • PDB: 4EN0 4J6G 4KG8 4KGG 4KGQ 4RSU
  • PDBsum: 4EN0 4J6G 4KG8 4KGG 4KGQ 4RSU
  • DIP: 3016
  • STRING: ENSP00000469049
• Other Databases: GeneCards:  TNFSF14  Malacards:  TNFSF14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031295	T cell costimulation	IDA	biological process
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031295	T cell costimulation	IEA	biological process
GO:1901741	positive regulation of myoblast fusion	IEA	biological process
GO:0045663	positive regulation of myoblast differentiation	IEA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043029	T cell homeostasis	NAS	biological process
GO:0042098	T cell proliferation	NAS	biological process
GO:0042110	T cell activation	NAS	biological process
GO:0007165	signal transduction	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04060	Cytokine-cytokine receptor interaction
hsa04064	NF-kappa B signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq