• Gene id: 8739

Gene Summary

• Gene Symbol: HRK   Gene   UCSC   Ensembl
• Aliases: DP5, HARAKIRI
• Gene name: harakiri, BCL2 interacting protein
• Alternate names: activator of apoptosis harakiri, BH3-interacting domain-containing protein 3, activator of apoptosis Hrk, death protein 5, harakiri, BCL2 interacting protein (contains only BH3 domain), neuronal death protein DP5,
• Gene location: 12q24.22 (116881440: 116856143)     Exons: 6     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the BCL-2 protein family. Members of this family are involved in activating or inhibiting apoptosis. The encoded protein localizes to intracellular membranes. This protein promotes apoptosis by interacting with the apoptotic
• OMIM: 603447

Protein Summary

• Protein general information: O00198  
  • Name: Activator of apoptosis harakiri (BH3 interacting domain containing protein 3) (Neuronal death protein DP5)
  • Length: 91  
  • Mass: 9884
• Sequence:

  MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAA
  AQVAALAAWLLGRRNL

• Structural information:
  • Interpro: IPR017249  IPR020728  
  • Prosite: PS01259
  • PDB: 2L58 2L5B
  • PDBsum: 2L58 2L5B
  • STRING: ENSP00000257572
• Other Databases: GeneCards:  HRK  Malacards:  HRK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031334	positive regulation of protein-containing complex assembly	IDA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04210	Apoptosis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)