• Gene id: 8738

Gene Summary

• Gene Symbol: CRADD   Gene   UCSC   Ensembl
• Aliases: MRT34, RAIDD
• Gene name: CASP2 and RIPK1 domain containing adaptor with death domain
• Alternate names: death domain-containing protein CRADD, CRADD/LYZ fusion, RIP-associated ICH1/CED3-homologous protein with death domain, caspase and RIP adaptor with death domain, death adaptor molecule RAIDD, death domain containing protein CRADD,
• Gene location: 12q22 (93677341: 93894839)     Exons: 13     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apop
• OMIM: 613976

Protein Summary

• Protein general information: P78560  
  • Name: Death domain containing protein CRADD (Caspase and RIP adapter with death domain) (RIP associated protein with a death domain)
  • Length: 199  
  • Mass: 22745
  • Tissue specificity: Constitutively expressed in most tissues, with particularly high expression in adult heart, testis, liver, skeletal muscle, fetal liver and kidney. {ECO
• Sequence:

  MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDS
  LQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKA
  NHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE

• Structural information:
  • Protein Domains: (1..9-)
    (/note="CARD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00046-)
    (116..18-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR001315  IPR042148  IPR037939  IPR037926  IPR011029   IPR000488  
  • Prosite: PS50209 PS50017
  • CDD: cd08327 cd08319
  • PDB: 2O71 2OF5 3CRD
  • PDBsum: 2O71 2OF5 3CRD
  • STRING: ENSP00000439068
• Other Databases: GeneCards:  CRADD  Malacards:  CRADD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	IBA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:2001235	positive regulation of apoptotic signaling pathway	IBA	biological process
GO:0071260	cellular response to mechanical stimulus	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0002020	protease binding	IBA	molecular function
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0070513	death domain binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:2001235	positive regulation of apoptotic signaling pathway	IEA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0030674	protein-macromolecule adaptor activity	IPI	molecular function
GO:0070513	death domain binding	IPI	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IC	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	IMP	biological process

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Syndromic autosomal recessive mental retardation	KEGG:H01911
Autosomal recessive mental retardation	KEGG:H00768
Syndromic autosomal recessive mental retardation	KEGG:H01911
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray