• Gene id: 873

Gene Summary

• Gene Symbol: CBR1   Gene   UCSC   Ensembl
• Aliases: CBR, SDR21C1, hCBR1
• Gene name: carbonyl reductase 1
• Alternate names: carbonyl reductase [NADPH] 1, 15-hydroxyprostaglandin dehydrogenase, NADPH-dependent carbonyl reductase 1, carbonyl reductase (NADPH) 1, epididymis secretory sperm binding protein, prostaglandin 9-ketoreductase, prostaglandin-E(2) 9-reductase, short chain dehydr,
• Gene location: 21q22.12 (36070023: 36073163)     Exons: 37     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics
• OMIM: 114830

SNPs

rs1799964

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31574531T>C
NC_000006.11   g.31542308T>C
NG_007462.1   g.3959T>C
NG_012010.1   g.7433T>C
NT_113891.3   g.3051818T>C
NT_113891.2   g.3051924T>C
NT_167246.2   g.2879572T>C
NT_167246.1   g.2885192T>C
NT_167249.2   g.2873811T>C
NT_167249.1   g.2873109T>C
NT  

Protein Summary

• Protein general information: P16152  
  • Name: Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15 hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.197) (NADPH dependent carbonyl reductase 1) (Prostaglandin 9 ketoreductase) (Prostaglandin E(2) 9 reductase) (EC 1.1.1.189) (Short chain dehydrogenase/
  • Length: 277  
  • Mass: 30375
• Sequence:

  MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRD
  FLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSC
  SPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNA
  CCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • PDB: 1WMA 2PFG 3BHI 3BHJ 3BHM 4Z3D
  • PDBsum: 1WMA 2PFG 3BHI 3BHJ 3BHM 4Z3D
  • DIP: 33136
  • STRING: ENSP00000290349
• Other Databases: GeneCards:  CBR1  Malacards:  CBR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004090	carbonyl reductase (NADPH) activity	IBA	molecular function
GO:0017144	drug metabolic process	IDA	biological process
GO:0004090	carbonyl reductase (NADPH) activity	IDA	molecular function
GO:0042373	vitamin K metabolic process	IDA	biological process
GO:0050221	prostaglandin-E2 9-reductase activity	ISS	molecular function
GO:0047021	15-hydroxyprostaglandin dehydrogenase (NADP+) activity	ISS	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004090	carbonyl reductase (NADPH) activity	TAS	molecular function
GO:0050221	prostaglandin-E2 9-reductase activity	IEA	molecular function
GO:0047044	androstan-3-alpha,17-beta-diol dehydrogenase activity	IEA	molecular function
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity	IEA	molecular function
GO:0004090	carbonyl reductase (NADPH) activity	IEA	molecular function
GO:0047021	15-hydroxyprostaglandin dehydrogenase (NADP+) activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0050221	prostaglandin-E2 9-reductase activity	TAS	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1903561	extracellular vesicle	HDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00590	Arachidonic acid metabolism
hsa00790	Folate biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881