• Gene id: 8726

Gene Summary

• Gene Symbol: EED   Gene   UCSC   Ensembl
• Aliases: COGIS, HEED, WAIT1
• Gene name: embryonic ectoderm development
• Alternate names: polycomb protein EED, WD protein associating with integrin cytoplasmic tails 1, embryonic ectoderm development protein,
• Gene location: 11q14.2 (86244383: 86285419)     Exons: 14     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts w
• OMIM: 605984

Protein Summary

• Protein general information: O75530  
  • Name: Polycomb protein EED (hEED) (Embryonic ectoderm development protein) (WD protein associating with integrin cytoplasmic tails 1) (WAIT 1)
  • Length: 441  
  • Mass: 50198
  • Tissue specificity: Expressed in brain, colon, heart, kidney, liver, lung, muscle, ovary, peripheral blood leukocytes, pancreas, placenta, prostate, spleen, small intestine, testis, thymus and uterus. Appears to be overexpressed in breast and colon cancer
• Sequence:

  MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKS
  KKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTC
  AWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTL
  VAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
  TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQK
  MLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR

• Structural information:
  • Interpro: IPR037352  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 3IIW 3IIY 3IJ0 3IJ1 3IJC 3JPX 3JZG 3JZH 3JZN 3K26 3K27 4W2R 4X3E 5GSA 5H13 5H14 5H15 5H17 5H19 5H24 5H25 5HYN 5IJ7 5IJ8 5K0M 5LS6 5TTW 5U5H 5U5K 5U5T 5U62 5U69 5U6D 5U8A 5U8F 5WG6 5WP3 5WUK 6B3W 6C23 6C24 6SFB 6SFC
  • PDBsum: 3IIW 3IIY 3IJ0 3IJ1 3IJC 3JPX 3JZG 3JZH 3JZN 3K26 3K27 4W2R 4X3E 5GSA 5H13 5H14 5H15 5H17 5H19 5H24 5H25 5HYN 5IJ7 5IJ8 5K0M 5LS6 5TTW 5U5H 5U5K 5U5T 5U62 5U69 5U6D 5U8A 5U8F 5WG6 5WP3 5WUK 6B3W 6C23 6C24 6SFB 6SFC
  • DIP: 36673
  • STRING: ENSP00000263360
• Other Databases: GeneCards:  EED  Malacards:  EED

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035098	ESC/E(Z) complex	IBA	cellular component
GO:0046976	histone methyltransferase activity (H3-K27 specific)	IBA	contributes to
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006342	chromatin silencing	IBA	biological process
GO:0031491	nucleosome binding	IBA	contributes to
GO:0042054	histone methyltransferase activity	IBA	contributes to
GO:0035098	ESC/E(Z) complex	IDA	cellular component
GO:0035098	ESC/E(Z) complex	IDA	cellular component
GO:0035098	ESC/E(Z) complex	IDA	cellular component
GO:0046976	histone methyltransferase activity (H3-K27 specific)	IMP	contributes to
GO:0042054	histone methyltransferase activity	IMP	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016571	histone methylation	IEA	biological process
GO:0035098	ESC/E(Z) complex	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0035098	ESC/E(Z) complex	IDA	cellular component
GO:0042054	histone methyltransferase activity	IDA	molecular function
GO:0045814	negative regulation of gene expression, epigenetic	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0070317	negative regulation of G0 to G1 transition	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021510	spinal cord development	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0045120	pronucleus	IEA	cellular component
GO:0035098	ESC/E(Z) complex	IEA	cellular component
GO:0016571	histone methylation	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0001739	sex chromatin	IEA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:2000011	regulation of adaxial/abaxial pattern formation	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0061087	positive regulation of histone H3-K27 methylation	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0006349	regulation of gene expression by genetic imprinting	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070734	histone H3-K27 methylation	IEA	biological process
GO:0070734	histone H3-K27 methylation	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	NAS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)