• Gene id: 8724

Gene Summary

• Gene Symbol: SNX3   Gene   UCSC   Ensembl
• Aliases: Grd19, MCOPS8, SDP3
• Gene name: sorting nexin 3
• Alternate names: sorting nexin-3, sorting nexin 3A,
• Gene location: 6q21 (108261039: 108211221)     Exons: 4     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like
• OMIM: 605930

Protein Summary

• Protein general information: O60493  
  • Name: Sorting nexin 3 (Protein SDP3)
  • Length: 162  
  • Mass: 18762
• Sequence:

  MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFE
  WLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEII
  DKSYTPSKIRHA

• Structural information:
  • Protein Domains: (27..15-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR001683  IPR036871  IPR042137  
  • Prosite: PS50195
  • CDD: cd07293
  • PDB: 2MXC 2YPS 5F0J 5F0L 5F0M 5F0P
  • PDBsum: 2MXC 2YPS 5F0J 5F0L 5F0M 5F0P
  • STRING: ENSP00000230085
• Other Databases: GeneCards:  SNX3  Malacards:  SNX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IDA	cellular component
GO:0031901	early endosome membrane	IBA	cellular component
GO:0032456	endocytic recycling	IBA	biological process
GO:0033157	regulation of intracellular protein transport	IBA	biological process
GO:0034499	late endosome to Golgi transport	IBA	biological process
GO:0032266	phosphatidylinositol-3-phosphate binding	IBA	molecular function
GO:0009617	response to bacterium	IDA	biological process
GO:0032009	early phagosome	IDA	cellular component
GO:0022615	protein to membrane docking	IDA	biological process
GO:0030136	clathrin-coated vesicle	IDA	cellular component
GO:0030904	retromer complex	IDA	colocalizes with
GO:0030904	retromer complex	IDA	colocalizes with
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0010008	endosome membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	ISS	molecular function
GO:0070273	phosphatidylinositol-4-phosphate binding	ISS	molecular function
GO:0010314	phosphatidylinositol-5-phosphate binding	ISS	molecular function
GO:0050765	negative regulation of phagocytosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030111	regulation of Wnt signaling pathway	IMP	biological process
GO:1901981	phosphatidylinositol phosphate binding	IEA	molecular function
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0010324	membrane invagination	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:2000642	negative regulation of early endosome to late endosome transport	IDA	biological process
GO:0042177	negative regulation of protein catabolic process	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0051224	negative regulation of protein transport	IDA	biological process
GO:0070676	intralumenal vesicle formation	IMP	biological process
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq