• Gene id: 8723

Gene Summary

• Gene Symbol: SNX4   Gene   UCSC   Ensembl
• Aliases: ATG24B
• Gene name: sorting nexin 4
• Alternate names: sorting nexin-4,
• Gene location: 3q21.2 (101917049: 101890673)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associated with the long isoform of the lept
• OMIM: 605931

Protein Summary

• Protein general information: O95219  
  • Name: Sorting nexin 4
  • Length: 450  
  • Mass: 51909
• Sequence:

  MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEISVSEAEKRTGRNAMN
  MQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVYYPHIVVPPLPEKRAEFVWHKLSADNMDPDF
  VERRRIGLENFLLRIASHPILCRDKIFYLFLTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKH
  YSDELQSVISHLLRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHY
  ADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARI
  KVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKECFSKM

• Structural information:
  • Protein Domains: (61..18-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR027267  IPR001683  IPR036871  IPR034902  IPR034783   IPR037430  
  • Prosite: PS50195
  • CDD: cd07622 cd06864
  • DIP: 36719
  • STRING: ENSP00000251775
• Other Databases: GeneCards:  SNX4  Malacards:  SNX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0005868	cytoplasmic dynein complex	IDA	cellular component
GO:0032456	endocytic recycling	IMP	biological process
GO:0035091	phosphatidylinositol binding	IMP	molecular function
GO:0015031	protein transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005154	epidermal growth factor receptor binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:1990459	transferrin receptor binding	IDA	molecular function
GO:0005158	insulin receptor binding	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0031201	SNARE complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:1990460	leptin receptor binding	IDA	molecular function
GO:1903595	positive regulation of histamine secretion by mast cell	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881