• Gene id: 8718

Gene Summary

• Gene Symbol: TNFRSF25   Gene   UCSC   Ensembl
• Aliases: APO-3, DDR3, DR3, LARD, TNFRSF12, TR3, TRAMP, WSL-1, WSL-LR
• Gene name: TNF receptor superfamily member 25
• Alternate names: tumor necrosis factor receptor superfamily member 25, apoptosis inducing receptor, apoptosis-inducing receptor AIR, apoptosis-mediating receptor DR3, apoptosis-mediating receptor TRAMP, death domain receptor 3 soluble form, death receptor beta, lymphocyte,
• Gene location: 1p36.31 (6466194: 6461150)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to st
• OMIM: 603366

Protein Summary

• Protein general information: Q93038  
  • Name: Tumor necrosis factor receptor superfamily member 25 (Apo 3) (Apoptosis inducing receptor AIR) (Apoptosis mediating receptor DR3) (Apoptosis mediating receptor TRAMP) (Death receptor 3) (Lymphocyte associated receptor of death) (LARD) (Protein WSL) (Prote
  • Length: 417  
  • Mass: 45,385
• Sequence:

  MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQ
  DTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRH
  TRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGATLTYTYR
  HCWPHKPLVTADEAGMEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNSWTPGYPETQEALCPQVTWSW
  DQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEFVRTLGLREAEIEAVEVEIGRFRDQQ
  YEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP

• Structural information:
  • Protein Domains: Death. (332-413)
  • Interpro: IPR011029  IPR000488  IPR001368  IPR022329  IPR034050  
  • Prosite: PS50017 PS00652 PS50050
  • CDD: cd13420
  • DIP: 59563
• Other Databases: GeneCards:  TNFRSF25  Malacards:  TNFRSF25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004872	receptor activity	NAS	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	NAS	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0042981	regulation of apoptotic process	NAS	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0004872	receptor activity	NAS	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0042981	regulation of apoptotic process	NAS	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0004872	receptor activity	NAS	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005829	cytosol	NAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0042981	regulation of apoptotic process	NAS	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Cancer (myeloma)	GAD: 20568250
Diabetes	GAD: 11793848
Necrozoospermia	MIK: 18572863
Cryptorchidism	MIK: 28606200
Necrozoospermia	MIK: 18572863

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18572863	Necrozoospermia			11 (10 healthy donors, 1 necrozoospermic patient)	Male infertility	Sperm protein (human accession No. 060904) zinc finger protein 174 (AW-1) F-actin capping protein alpha-3 subunit testis-specific inhibitor of apoptosis death domain receptor 3 soluble form (fragment) and peptide similar to the activator of CREM in t
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq