• Gene id: 8717

Gene Summary

• Gene Symbol: TRADD   Gene   UCSC   Ensembl
• Aliases: Hs.89862
• Gene name: TNFRSF1A associated via death domain
• Alternate names: tumor necrosis factor receptor type 1-associated DEATH domain protein, TNFR1-associated death domain protein, tumor necrosis factor receptor type 1 associated death domain protein, tumor necrosis factor receptor-1-associated protein,
• Gene location: 16q22.1 (67159908: 67154184)     Exons: 6     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of i
• OMIM: 613478

Protein Summary

• Protein general information: Q15628  
  • Name: Tumor necrosis factor receptor type 1 associated DEATH domain protein (TNFR1 associated DEATH domain protein) (TNFRSF1A associated via death domain)
  • Length: 312  
  • Mass: 34247
  • Tissue specificity: Found in all examined tissues.
• Sequence:

  MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQL
  RFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDE
  ELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARS
  VGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
  LLGLTDPNGGLA

• Structural information:
  • Protein Domains: (179..28-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR011029  IPR000488  IPR035712  IPR009095  IPR036729  
  • Prosite: PS50017
  • PDB: 1F2H 1F3V 5XME 6AC0
  • PDBsum: 1F2H 1F3V 5XME 6AC0
  • DIP: 285
  • STRING: ENSP00000341268
• Other Databases: GeneCards:  TRADD  Malacards:  TRADD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0050729	positive regulation of inflammatory response	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0071356	cellular response to tumor necrosis factor	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity	IBA	molecular function
GO:0097191	extrinsic apoptotic signaling pathway	IBA	biological process
GO:0002947	tumor necrosis factor receptor superfamily complex	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0060090	molecular adaptor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0071550	death-inducing signaling complex assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0051798	positive regulation of hair follicle development	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0070513	death domain binding	IPI	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0002947	tumor necrosis factor receptor superfamily complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097191	extrinsic apoptotic signaling pathway	TAS	biological process
GO:0031264	death-inducing signaling complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05165	Human papillomavirus infection
hsa04010	MAPK signaling pathway
hsa05131	Shigellosis
hsa05132	Salmonella infection
hsa05163	Human cytomegalovirus infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05152	Tuberculosis
hsa04217	Necroptosis
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa04210	Apoptosis
hsa04071	Sphingolipid signaling pathway
hsa05162	Measles
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04657	IL-17 signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04920	Adipocytokine signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq