• Gene id: 8698

Gene Summary

• Gene Symbol: S1PR4   Gene   UCSC   Ensembl
• Aliases: EDG6, LPC1, S1P4, SLP4
• Gene name: sphingosine-1-phosphate receptor 4
• Alternate names: sphingosine 1-phosphate receptor 4, S1P receptor 4, S1P receptor Edg-6, endothelial differentiation G-protein coupled receptor 6, endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 6, sphingosine 1-phosphate receptor Edg-6,
• Gene location: 19p13.3 (3178768: 3180331)     Exons: 1     NC_000019.10
• Gene summary(Entrez): This gene is a member of the endothelial differentiation, G-protein-coupled (EDG)) receptor gene family. EDG receptors bind lysophospholipids or lysosphingolipids as ligands, and are involved in cell signalling in many different cell types. This EDG recep
• OMIM: 615903

Protein Summary

• Protein general information: O95977  
  • Name: Sphingosine 1 phosphate receptor 4 (S1P receptor 4) (S1P4) (Endothelial differentiation G protein coupled receptor 6) (Sphingosine 1 phosphate receptor Edg 6) (S1P receptor Edg 6)
  • Length: 384  
  • Mass: 41623
  • Tissue specificity: Specifically expressed in fetal and adult lymphoid and hematopoietic tissue as well as in lung. Considerable level of expression in adult and fetal spleen as well as adult peripheral leukocytes and lung. Lower expression in adult thymu
• Sequence:

  MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLVVLENLLVLAAITSHM
  RSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFLREGLLFTALAASTFSLLFTAGERFATMVRP
  VAESGATKTSRVYGFIGLCWLLAALLGMLPLLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGA
  IFRLVQASGQKAPRPAARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
  AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDSFRGSRSLSFRMREPL
  SSISSVRSI

• Structural information:
  • Interpro: IPR004064  IPR000276  IPR017452  IPR004061  
  • Prosite: PS50262
  • PDB: 2DCO
  • PDBsum: 2DCO
  • STRING: ENSP00000246115
• Other Databases: GeneCards:  S1PR4  Malacards:  S1PR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0038036	sphingosine-1-phosphate receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0008289	lipid binding	TAS	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007202	activation of phospholipase C activity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003376	sphingosine-1-phosphate receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04071	Sphingolipid signaling pathway
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881