• Gene id: 8692

Gene Summary

• Gene Symbol: HYAL2   Gene   UCSC   Ensembl
• Aliases: LUCA2
• Gene name: hyaluronidase 2
• Alternate names: hyaluronidase-2, PH-20 homolog, PH20 homolog, hyal-2, hyaluronoglucosaminidase 2, lung carcinoma protein 2, lysosomal hyaluronidase,
• Gene location: 3p21.31 (50322849: 50317789)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene encodes a weak acid-active hyaluronidase. The encoded protein is similar in structure to other more active hyaluronidases. Hyaluronidases degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan and fragmen
• OMIM: 612772

Protein Summary

• Protein general information: Q12891  
  • Name: Hyaluronidase 2 (Hyal 2) (EC 3.2.1.35) (Hyaluronoglucosaminidase 2) (Lung carcinoma protein 2) (LuCa 2)
  • Length: 473  
  • Mass: 53860
  • Tissue specificity: Widely expressed. No expression detected in adult brain. {ECO
• Sequence:

  MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGFVNQNI
  TIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPVWVRNWQDKDV
  YRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTG
  RCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
  RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSWATQYCSRAQCHGHGR
  CVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDHLQTHFRCQCYLGWSGEQCQWDHRQAAGGAS
  EAWAGSHLTSLLALAALAFTWTL

• Structural information:
  • Protein Domains: (361..43-)
    (/note="EGF-like"-)
  • Interpro: IPR013785  IPR017853  IPR018155  
  • Prosite: PS00022 PS01186
  • STRING: ENSP00000401853
• Other Databases: GeneCards:  HYAL2  Malacards:  HYAL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0004415	hyalurononglucosaminidase activity	TAS	molecular function
GO:0030214	hyaluronan catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:0090575	RNA polymerase II transcription regulator complex	IEA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0050431	transforming growth factor beta binding	IEA	molecular function
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0042307	positive regulation of protein import into nucleus	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0060586	multicellular organismal iron ion homeostasis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0031362	anchored component of external side of plasma membrane	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0010259	multicellular organism aging	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0050431	transforming growth factor beta binding	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IDA	biological process
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0042307	positive regulation of protein import into nucleus	ISS	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	ISS	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	ISS	biological process
GO:0090575	RNA polymerase II transcription regulator complex	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0042117	monocyte activation	IDA	biological process
GO:0030294	receptor signaling protein tyrosine kinase inhibitor activity	IDA	molecular function
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0019087	transformation of host cell by virus	IDA	biological process
GO:0019064	fusion of virus membrane with host plasma membrane	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0006027	glycosaminoglycan catabolic process	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IDA	biological process
GO:0071493	cellular response to UV-B	IDA	biological process
GO:0071347	cellular response to interleukin-1	IDA	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	IDA	biological process
GO:0033906	hyaluronoglucuronidase activity	IDA	molecular function
GO:0031362	anchored component of external side of plasma membrane	IDA	cellular component
GO:0031362	anchored component of external side of plasma membrane	IDA	cellular component
GO:0031362	anchored component of external side of plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0010764	negative regulation of fibroblast migration	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	NOT|molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0001618	virus receptor activity	IDA	molecular function
GO:0001618	virus receptor activity	IDA	molecular function
GO:0000302	response to reactive oxygen species	IDA	biological process
GO:0051898	negative regulation of protein kinase B signaling	IDA	biological process
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0031362	anchored component of external side of plasma membrane	IDA	colocalizes with
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0046677	response to antibiotic	IEP	biological process
GO:0000139	Golgi membrane	ISS	cellular component
GO:0046718	viral entry into host cell	ISS	biological process
GO:0035810	positive regulation of urine volume	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051216	cartilage development	IEP	biological process
GO:0019087	transformation of host cell by virus	ISS	biological process
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0001822	kidney development	ISS	biological process
GO:0070295	renal water absorption	ISS	biological process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0004415	hyalurononglucosaminidase activity	TAS	molecular function
GO:0030214	hyaluronan catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:0090575	RNA polymerase II transcription regulator complex	IEA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0050431	transforming growth factor beta binding	IEA	molecular function
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0042307	positive regulation of protein import into nucleus	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0060586	multicellular organismal iron ion homeostasis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0031362	anchored component of external side of plasma membrane	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0010259	multicellular organism aging	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0050431	transforming growth factor beta binding	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IDA	biological process
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0042307	positive regulation of protein import into nucleus	ISS	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	ISS	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	ISS	biological process
GO:0090575	RNA polymerase II transcription regulator complex	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0042117	monocyte activation	IDA	biological process
GO:0030294	receptor signaling protein tyrosine kinase inhibitor activity	IDA	molecular function
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0019087	transformation of host cell by virus	IDA	biological process
GO:0019064	fusion of virus membrane with host plasma membrane	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0006027	glycosaminoglycan catabolic process	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IDA	biological process
GO:0071493	cellular response to UV-B	IDA	biological process
GO:0071347	cellular response to interleukin-1	IDA	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	IDA	biological process
GO:0033906	hyaluronoglucuronidase activity	IDA	molecular function
GO:0031362	anchored component of external side of plasma membrane	IDA	cellular component
GO:0031362	anchored component of external side of plasma membrane	IDA	cellular component
GO:0031362	anchored component of external side of plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0010764	negative regulation of fibroblast migration	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	NOT|molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0001618	virus receptor activity	IDA	molecular function
GO:0001618	virus receptor activity	IDA	molecular function
GO:0000302	response to reactive oxygen species	IDA	biological process
GO:0051898	negative regulation of protein kinase B signaling	IDA	biological process
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0031362	anchored component of external side of plasma membrane	IDA	colocalizes with
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0046677	response to antibiotic	IEP	biological process
GO:0000139	Golgi membrane	ISS	cellular component
GO:0046718	viral entry into host cell	ISS	biological process
GO:0035810	positive regulation of urine volume	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051216	cartilage development	IEP	biological process
GO:0019087	transformation of host cell by virus	ISS	biological process
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0001822	kidney development	ISS	biological process
GO:0070295	renal water absorption	ISS	biological process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04142	Lysosome
hsa00531	Glycosaminoglycan degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881