• Gene id: 8682

Gene Summary

• Gene Symbol: PEA15   Gene   UCSC   Ensembl
• Aliases: HMAT1, HUMMAT1H, MAT1, MAT1H, PEA-15, PED, PED-PEA15, PED/PEA15
• Gene name: proliferation and apoptosis adaptor protein 15
• Alternate names: astrocytic phosphoprotein PEA-15, 15 kDa phosphoprotein enriched in astrocytes, homolog of mouse MAT-1 oncogene, mammary transforming gene 1, mouse, homolog of, phosphoprotein enriched in astrocytes 15, phosphoprotein enriched in diabetes, proliferation and apo,
• Gene location: 1q23.2 (160205383: 160215375)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it
• OMIM: 603434

Protein Summary

• Protein general information: Q15121  
  • Name: Astrocytic phosphoprotein PEA 15 (15 kDa phosphoprotein enriched in astrocytes) (Phosphoprotein enriched in diabetes) (PED)
  • Length: 130  
  • Mass: 15040
  • Tissue specificity: Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues
• Sequence:

  MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDL
  LTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

• Structural information:
  • Protein Domains: (3..8-)
    (/note="DED-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00065"-)
  • Interpro: IPR011029  IPR001875  IPR029546  
  • Prosite: PS50168
  • CDD: cd08338
  • PDB: 4IZ5 4IZA 6P6B 6P6C
  • PDBsum: 4IZ5 4IZA 6P6B 6P6C
  • STRING: ENSP00000357055
• Other Databases: GeneCards:  PEA15  Malacards:  PEA15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902043	positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0046325	negative regulation of glucose import	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005875	microtubule associated complex	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881