• Gene id: 8678

Gene Summary

• Gene Symbol: BECN1   Gene   UCSC   Ensembl
• Aliases: ATG6, VPS30, beclin1
• Gene name: beclin 1
• Alternate names: beclin-1, ATG6 autophagy related 6 homolog, beclin 1 (coiled-coil, moesin-like BCL2-interacting protein), beclin 1, autophagy related, coiled-coil myosin-like BCL2-interacting protein, testis secretory sperm-binding protein Li 215e,
• Gene location: 17q21.31 (42824315: 42810131)     Exons: 13     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This prote
• OMIM: 604378

Protein Summary

• Protein general information: Q14457  
  • Name: Beclin 1 (Coiled coil myosin like BCL2 interacting protein) (Protein GT197) [Cleaved into: Beclin 1 C 35 kDa; Beclin 1 C 37 kDa]
  • Length: 450  
  • Mass: 51896
  • Tissue specificity: Ubiquitous.
• Sequence:

  MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQ
  DGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDT
  QLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQE
  EAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
  NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDC
  VQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK

• Structural information:
  • Interpro: IPR007243  IPR038274  IPR041691  IPR040455  IPR032913   IPR029318  
  • PDB: 2P1L 2PON 3DVU 4DDP 4MI8 5EFM 5HHE 5VAU 5VAX 5VAY 6DCN 6DCO 6HOI 6HOJ 6HOK
  • PDBsum: 2P1L 2PON 3DVU 4DDP 4MI8 5EFM 5HHE 5VAU 5VAX 5VAY 6DCN 6DCO 6HOI 6HOJ 6HOK
  • DIP: 44611
  • STRING: ENSP00000355231
• Other Databases: GeneCards:  BECN1  Malacards:  BECN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019901	protein kinase binding	IPI	molecular function
GO:0043548	phosphatidylinositol 3-kinase binding	IPI	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	NAS	biological process
GO:0000423	mitophagy	IMP	biological process
GO:0005739	mitochondrion	IMP	colocalizes with
GO:0000422	autophagy of mitochondrion	IMP	biological process
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:1902425	positive regulation of attachment of mitotic spindle microtubules to kinetochore	IMP	biological process
GO:0006914	autophagy	IMP	biological process
GO:0000045	autophagosome assembly	IBA	biological process
GO:0034271	phosphatidylinositol 3-kinase complex, class III, type I	IBA	cellular component
GO:0000407	phagophore assembly site	IBA	cellular component
GO:0006995	cellular response to nitrogen starvation	IBA	biological process
GO:0019898	extrinsic component of membrane	IBA	cellular component
GO:0034272	phosphatidylinositol 3-kinase complex, class III, type II	IBA	cellular component
GO:0045324	late endosome to vacuole transport	IBA	biological process
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0032801	receptor catabolic process	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	ISS	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035032	phosphatidylinositol 3-kinase complex, class III	ISS	cellular component
GO:0016236	macroautophagy	ISS	biological process
GO:0000045	autophagosome assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006897	endocytosis	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0032465	regulation of cytokinesis	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098780	response to mitochondrial depolarisation	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006914	autophagy	IMP	biological process
GO:0006914	autophagy	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051020	GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05131	Shigellosis
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa04371	Apelin signaling pathway
hsa04137	Mitophagy - animal
hsa04136	Autophagy - other
hsa04215	Apoptosis - multiple species

Diseases

Associated diseases	References
Alzheimer's disease	PMID:18497889
hypertrophic cardiomyopathy	PMID:25209900
Machado-Joseph disease	PMID:21478185
Machado-Joseph disease	PMID:21478185
Mental depression	PMID:25386878
Glioblastoma multiforme	PMID:20863706
esophagus adenocarcinoma	PMID:22301112
intrahepatic cholangiocarcinoma	PMID:30849962
Osteoarthritis	PMID:20187128
Barrett's esophagus	PMID:22301112
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)