• Gene id: 8675

Gene Summary

• Gene Symbol: STX16   Gene   UCSC   Ensembl
• Aliases: SYN16
• Gene name: syntaxin 16
• Alternate names: syntaxin-16,
• Gene location: 20q13.32 (58651282: 58679525)     Exons: 9     NC_000020.11
• Gene summary(Entrez): This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking a
• OMIM: 603666

Protein Summary

• Protein general information: O14662  
  • Name: Syntaxin 16 (Syn16)
  • Length: 325  
  • Mass: 37031
  • Tissue specificity: Ubiquitous.
• Sequence:

  MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPP
  PKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARAC
  SEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVL
  VEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNR
  KMLVILILFVIIIVLIVVLVGVKSR

• Structural information:
  • Protein Domains: (230..29-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR010989  IPR028673  IPR006012  IPR006011  IPR000727  
  • Prosite: PS00914 PS50192
  • DIP: 57570
  • STRING: ENSP00000360183
• Other Databases: GeneCards:  STX16  Malacards:  STX16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005484	SNAP receptor activity	IDA	molecular function
GO:0031201	SNARE complex	TAS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0048278	vesicle docking	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0006906	vesicle fusion	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0000149	SNARE binding	IBA	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0031201	SNARE complex	IEA	cellular component
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0031201	SNARE complex	IDA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0031985	Golgi cisterna	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0019905	syntaxin binding	IPI	molecular function
GO:0090161	Golgi ribbon formation	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Pseudohypoparathyroidism	KEGG:H00244
Pseudohypoparathyroidism	KEGG:H00244
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)