About Us

Search Result


Gene id 8669
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol EIF3J   Gene   UCSC   Ensembl
Aliases EIF3S1, eIF3-alpha, eIF3-p35
Gene name eukaryotic translation initiation factor 3 subunit J
Alternate names eukaryotic translation initiation factor 3 subunit J, eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD),
Gene location 15q21.1 (35342557: 35428190)     Exons: 13     NC_000006.12
Gene summary(Entrez) This gene encodes a core subunit of the eukaryotic initiation factor 3 complex, which participates in the initiation of translation by aiding in the recruitment of protein and mRNA components to the 40S ribosome. There are pseudogenes for this gene on chr
OMIM 603910

Protein Summary

Protein general information O75822  

Name: Eukaryotic translation initiation factor 3 subunit J (eIF3j) (Eukaryotic translation initiation factor 3 subunit 1) (eIF 3 alpha) (eIF3 p35)

Length: 258  Mass: 29062

Sequence MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKK
KIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNP
SSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKG
VVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Structural information
Interpro:  IPR023194  IPR013906  

PDB:  
2KRB 3BPJ
PDBsum:   2KRB 3BPJ

DIP:  

31117

MINT:  
STRING:   ENSP00000261868
Other Databases GeneCards:  EIF3J  Malacards:  EIF3J

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IBA cellular component
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IEA cellular component
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006412 translation
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0006413 translational initiation
IEA biological process
GO:0006413 translational initiation
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0016282 eukaryotic 43S preinitiat
ion complex
IEA cellular component
GO:0002183 cytoplasmic translational
initiation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0033290 eukaryotic 48S preinitiat
ion complex
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0001732 formation of cytoplasmic
translation initiation co
mplex
IEA biological process
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IEA cellular component
GO:0003743 translation initiation fa
ctor activity
IC contributes to
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0003743 translation initiation fa
ctor activity
IC contributes to
GO:0006413 translational initiation
IC biological process
GO:0006413 translational initiation
IC biological process
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03013RNA transport
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract