About Us

Search Result


Gene id 8663
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol EIF3C   Gene   UCSC   Ensembl
Aliases EIF3CL, EIF3S8, eIF3-p110
Gene name eukaryotic translation initiation factor 3 subunit C
Alternate names eukaryotic translation initiation factor 3 subunit C, cell migration-inducing protein 17, eIF3 p110, eukaryotic translation initiation factor 3 subunit 8, eukaryotic translation initiation factor 3, subunit 8 (110kD), eukaryotic translation initiation factor 3,
Gene location 16p11.2 (28688557: 28735729)     Exons: 29     NC_000016.10
OMIM 603916

Protein Summary

Protein general information Q99613  

Name: Eukaryotic translation initiation factor 3 subunit C (eIF3c) (Eukaryotic translation initiation factor 3 subunit 8) (eIF3 p110)

Length: 913  Mass: 105344

Sequence MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRD
VTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNR
DFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDS
EDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGE
WERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIK
FNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVER
MDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTP
PEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQH
ADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHL
HINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWK
TCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKM
IINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMR
RGGYRQQQSQTAY
Structural information
Protein Domains
(673..84-)
(/note="PCI-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
Interpro:  IPR027516  IPR008905  IPR000717  IPR036388  IPR036390  
Prosite:   PS50250

PDB:  
3J8B 3J8C
PDBsum:   3J8B 3J8C

DIP:  

32865

MINT:  
STRING:   ENSP00000332604
Other Databases GeneCards:  EIF3C  Malacards:  EIF3C

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
IPI molecular function
GO:0045727 positive regulation of tr
anslation
IPI biological process
GO:1902416 positive regulation of mR
NA binding
IPI biological process
GO:0031369 translation initiation fa
ctor binding
IBA molecular function
GO:0003743 translation initiation fa
ctor activity
IBA contributes to
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IBA cellular component
GO:0006413 translational initiation
IBA biological process
GO:0003743 translation initiation fa
ctor activity
IDA contributes to
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0031369 translation initiation fa
ctor binding
IEA molecular function
GO:0003723 RNA binding
IEA molecular function
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IEA cellular component
GO:0006413 translational initiation
IEA biological process
GO:0006412 translation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0006413 translational initiation
IEA biological process
GO:0043022 ribosome binding
IDA molecular function
GO:0006413 translational initiation
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0033290 eukaryotic 48S preinitiat
ion complex
IEA cellular component
GO:0002183 cytoplasmic translational
initiation
IEA biological process
GO:0016282 eukaryotic 43S preinitiat
ion complex
IEA cellular component
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0001732 formation of cytoplasmic
translation initiation co
mplex
IEA biological process
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0003743 translation initiation fa
ctor activity
IDA contributes to
GO:0003743 translation initiation fa
ctor activity
IC contributes to
GO:0003743 translation initiation fa
ctor activity
IC contributes to
GO:0006413 translational initiation
IDA biological process
GO:0006413 translational initiation
IC biological process
GO:0006413 translational initiation
IC biological process
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0003723 RNA binding
HDA molecular function
GO:0003723 RNA binding
HDA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03013RNA transport
Associated diseases References
Cryptorchidism MIK: 21412036
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21412036 Cryptorchi
dism

23 (4 controls,
19 cases)
Male infertility GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract