• Gene id: 8661

Gene Summary

• Gene Symbol: EIF3A   Gene   UCSC   Ensembl
• Aliases: EIF3, EIF3S10, P167, TIF32, eIF3-p170, eIF3-theta, p180, p185
• Gene name: eukaryotic translation initiation factor 3 subunit A
• Alternate names: eukaryotic translation initiation factor 3 subunit A, EIF3, p180 subunit, centrosomin homolog, cytoplasmic protein p167, eIF-3-theta, eIF3 p167, eIF3 p180, eIF3 p185, eukaryotic translation initiation factor 3 subunit 10, eukaryotic translation initiation factor 3,
• Gene location: 10q26.11 (37847570: 37838835)     Exons: 5     NC_000023.11
• OMIM: 602039

Protein Summary

• Protein general information: Q14152  
  • Name: Eukaryotic translation initiation factor 3 subunit A (eIF3a) (Eukaryotic translation initiation factor 3 subunit 10) (eIF 3 theta) (eIF3 p167) (eIF3 p180) (eIF3 p185)
  • Length: 1382  
  • Mass: 166569
• Sequence:

  MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
  NICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWV
  KFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPES
  QSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
  HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMV
  RFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSI
  EFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTA
  MSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
  LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVE
  QLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRM
  SRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKE
  REERERAERAKREEELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWR
  KGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEED
  RFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRR
  GGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADD
  DRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEE
  REWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRR
  ERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRVPPPALSRDRERDRDREREGE
  KEKASWRAEKDRESLRRTKNETDEDGWTTVRR

• Structural information:
  • Protein Domains: (315..49-)
    (/note="PCI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
  • Interpro: IPR027512  IPR000717  
  • Prosite: PS50250
  • PDB: 3J8B 3J8C
  • PDBsum: 3J8B 3J8C
  • DIP: 31114
  • STRING: ENSP00000358140
• Other Databases: GeneCards:  EIF3A  Malacards:  EIF3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002188	translation reinitiation	IBA	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0003743	translation initiation factor activity	IBA	contributes to
GO:0001732	formation of cytoplasmic translation initiation complex	IBA	biological process
GO:0043614	multi-eIF complex	IBA	cellular component
GO:0071540	eukaryotic translation initiation factor 3 complex, eIF3e	IBA	cellular component
GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m	IBA	cellular component
GO:0075522	IRES-dependent viral translational initiation	IDA	biological process
GO:0075525	viral translational termination-reinitiation	IDA	biological process
GO:0075522	IRES-dependent viral translational initiation	IDA	biological process
GO:0075522	IRES-dependent viral translational initiation	IDA	biological process
GO:0003743	translation initiation factor activity	IDA	contributes to
GO:0003723	RNA binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005852	eukaryotic translation initiation factor 3 complex	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005852	eukaryotic translation initiation factor 3 complex	IEA	cellular component
GO:0001732	formation of cytoplasmic translation initiation complex	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0002183	cytoplasmic translational initiation	IEA	biological process
GO:0033290	eukaryotic 48S preinitiation complex	IEA	cellular component
GO:0016282	eukaryotic 43S preinitiation complex	IEA	cellular component
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005852	eukaryotic translation initiation factor 3 complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001732	formation of cytoplasmic translation initiation complex	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003743	translation initiation factor activity	IDA	contributes to
GO:0003743	translation initiation factor activity	IC	contributes to
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0001732	formation of cytoplasmic translation initiation complex	IDA	biological process
GO:0003743	translation initiation factor activity	IC	contributes to
GO:0006413	translational initiation	IC	biological process
GO:0006413	translational initiation	IC	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005198	structural molecule activity	NAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005737	cytoplasm	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881