• Gene id: 8660

Gene Summary

• Gene Symbol: IRS2   Gene   UCSC   Ensembl
• Aliases: IRS-2
• Gene name: insulin receptor substrate 2
• Alternate names: insulin receptor substrate 2,
• Gene location: 13q34 (109786582: 109752694)     Exons: 2     NC_000013.11
• Gene summary(Entrez): This gene encodes the insulin receptor substrate 2, a cytoplasmic signaling molecule that mediates effects of insulin, insulin-like growth factor 1, and other cytokines by acting as a molecular adaptor between diverse receptor tyrosine kinases and downstr
• OMIM: 600797

Protein Summary

• Protein general information: Q9Y4H2  
  • Name: Insulin receptor substrate 2 (IRS 2)
  • Length: 1338  
  • Mass: 137334
• Sequence:

  MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEATAGGGSAPQPPRLEY
  YESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDEYFAVAAENEQEQEGWYRALTDLVSEGRAAA
  GDAPPAAAPAASCSASLPGALGGSAGAAGAEDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSART
  IGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
  RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCRVRTASEGDGGAAAGA
  AAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLPAGGALQHSRSMSMPVAHSPPAATSPGSLSS
  SSGHGSGSYPPPPGPHPPLPHPLHHGPGQRPSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIA
  ETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
  MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGAALAGSGSGSCRSDDY
  MPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTFPASGGGYKASSPAESSPEDSGYMRMWCGSK
  LSMEHADGKLLPNGDYLNVSPSDAVTTGTPPDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVL
  MSSPVGRILEEERLEPQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
  LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGSGTPGTSSDSRQRSPL
  SDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPRPSASPSSSLQPPPPPPAPGELYRLPPASAV
  ATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQ
  PPDPHRGAKVIRADPQGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
  PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVREEPGLPPQPQPPPPPL
  PQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTYASIDFLSHHLKEATIVKE

• Structural information:
  • Protein Domains: (16..14-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (194..29-)
    (/note="IRS-type-PTB)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00389"-)
  • Interpro: IPR039011  IPR002404  IPR011993  IPR001849  
  • Prosite: PS51064 PS50003
  • CDD: cd01204
  • PDB: 3FQW 3FQX
  • PDBsum: 3FQW 3FQX
  • STRING: ENSP00000365016
• Other Databases: GeneCards:  IRS2  Malacards:  IRS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005158	insulin receptor binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0008286	insulin receptor signaling pathway	IBA	biological process
GO:0043548	phosphatidylinositol 3-kinase binding	IBA	molecular function
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0005158	insulin receptor binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006006	glucose metabolic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0046579	positive regulation of Ras protein signal transduction	TAS	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0038111	interleukin-7-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043548	phosphatidylinositol 3-kinase binding	IEA	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0071889	14-3-3 protein binding	IEA	molecular function
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0043548	phosphatidylinositol 3-kinase binding	IEA	molecular function
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0033673	negative regulation of kinase activity	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0030879	mammary gland development	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0002903	negative regulation of B cell apoptotic process	IEA	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	IEA	biological process
GO:1901653	cellular response to peptide	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0019903	protein phosphatase binding	IEA	molecular function
GO:0005158	insulin receptor binding	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	NAS	biological process
GO:0008286	insulin receptor signaling pathway	ISS	biological process
GO:0009749	response to glucose	ISS	biological process
GO:0010907	positive regulation of glucose metabolic process	IMP	biological process
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0032869	cellular response to insulin stimulus	IMP	biological process
GO:0002903	negative regulation of B cell apoptotic process	ISS	biological process
GO:0010748	negative regulation of long-chain fatty acid import across plasma membrane	IMP	biological process
GO:0030890	positive regulation of B cell proliferation	ISS	biological process
GO:0032000	positive regulation of fatty acid beta-oxidation	IMP	biological process
GO:0032024	positive regulation of insulin secretion	ISS	biological process
GO:0033673	negative regulation of kinase activity	ISS	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	NAS	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	IMP	biological process
GO:0046326	positive regulation of glucose import	IMP	biological process
GO:0055088	lipid homeostasis	TAS	biological process
GO:0005829	cytosol	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05206	MicroRNAs in cancer
hsa04022	cGMP-PKG signaling pathway
hsa04140	Autophagy - animal
hsa04932	Non-alcoholic fatty liver disease
hsa04910	Insulin signaling pathway
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04931	Insulin resistance
hsa04211	Longevity regulating pathway
hsa04920	Adipocytokine signaling pathway
hsa04213	Longevity regulating pathway - multiple species
hsa04930	Type II diabetes mellitus
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Alzheimer's disease	PMID:18479783
type 2 diabetes mellitus	PMID:11030756
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray