• Gene id: 8658

Gene Summary

• Gene Symbol: TNKS   Gene   UCSC   Ensembl
• Aliases: ARTD5, PARP-5a, PARP5A, PARPL, TIN1, TINF1, TNKS1, pART5
• Gene name: tankyrase
• Alternate names: poly [ADP-ribose] polymerase tankyrase-1, ADP-ribosyltransferase diphtheria toxin-like 5, TANK1, TNKS-1, TRF1-interacting ankyrin-related ADP-ribose polymerase 1, poly [ADP-ribose] polymerase 5A, protein poly-ADP-ribosyltransferase tankyrase-1, tankyrase I, tanky,
• Gene location: 8p23.1 (9423536: 9473109)     Exons: 19     NC_000002.12
• OMIM: 603303

Protein Summary

• Protein general information: O95271  
  • Name: Poly [ADP ribose] polymerase tankyrase 1 (EC 2.4.2.30) (ADP ribosyltransferase diphtheria toxin like 5) (ARTD5) (Poly [ADP ribose] polymerase 5A) (Protein poly ADP ribosyltransferase tankyrase 1) (EC 2.4.2. ) (TNKS 1) (TRF1 interacting ankyrin related ADP
  • Length: 1327  
  • Mass: 142039
  • Tissue specificity: Ubiquitous; highest levels in testis.
• Sequence:

  MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPP
  DRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSL
  AESPEAAGVSSTAPLGPGAAGPGTGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAG
  FGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIV
  LLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHL
  AAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEV
  CSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETA
  LHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAAL
  AGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNV
  NCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWK
  FTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTP
  ENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATD
  KWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSAS
  LISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETE
  QITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEM
  QSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER
  HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGH
  HSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT

• Structural information:
  • Protein Domains: (1030..108-)
    (/note="SAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00184-)
    (1112..131-)
    (/note="PARP-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00397"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR012317  IPR001660   IPR013761  IPR028731  
  • Prosite: PS50297 PS50088 PS51059 PS50105
  • PDB: 2RF5 3UDD 3UH2 3UH4 4DVI 4I9I 4K4E 4K4F 4KRS 4LI6 4LI7 4LI8 4MSG 4MSK 4MT9 4N3R 4N4V 4OA7 4TOR 4TOS 4U6A 4UUH 4UW1 4W5S 4W6E 5EBT 5ECE 5ETY 5GP7 5JHQ 5JTI 5JU5 5KNI 6QXU
  • PDBsum: 2RF5 3UDD 3UH2 3UH4 4DVI 4I9I 4K4E 4K4F 4KRS 4LI6 4LI7 4LI8 4MSG 4MSK 4MT9 4N3R 4N4V 4OA7 4TOR 4TOS 4U6A 4UUH 4UW1 4W5S 4W6E 5EBT 5ECE 5ETY 5GP7 5JHQ 5JTI 5JU5 5KNI 6QXU
  • DIP: 36652
  • STRING: ENSP00000311579
• Other Databases: GeneCards:  TNKS  Malacards:  TNKS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003950	NAD+ ADP-ribosyltransferase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0070198	protein localization to chromosome, telomeric region	IBA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0006471	protein ADP-ribosylation	IBA	biological process
GO:1904355	positive regulation of telomere capping	IBA	biological process
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:1990404	protein ADP-ribosylase activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0070212	protein poly-ADP-ribosylation	IDA	biological process
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0070212	protein poly-ADP-ribosylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IEA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IEA	molecular function
GO:0051225	spindle assembly	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	TAS	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0031670	cellular response to nutrient	IEA	biological process
GO:1904908	negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric	IMP	biological process
GO:0042393	histone binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:0051973	positive regulation of telomerase activity	IDA	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IDA	biological process
GO:1904355	positive regulation of telomere capping	IDA	biological process
GO:0070198	protein localization to chromosome, telomeric region	IMP	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:1904743	negative regulation of telomeric DNA binding	IMP	biological process
GO:1904357	negative regulation of telomere maintenance via telomere lengthening	IMP	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0070212	protein poly-ADP-ribosylation	IMP	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IDA	biological process
GO:1904743	negative regulation of telomeric DNA binding	IDA	biological process
GO:0000242	pericentriolar material	TAS	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0007052	mitotic spindle organization	TAS	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0032210	regulation of telomere maintenance via telomerase	IC	biological process
GO:0070212	protein poly-ADP-ribosylation	IDA	biological process
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031965	nuclear membrane	TAS	cellular component
GO:0051225	spindle assembly	TAS	biological process
GO:0070198	protein localization to chromosome, telomeric region	IMP	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0000781	chromosome, telomeric region	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray