• Gene id: 8651

Gene Summary

• Gene Symbol: SOCS1   Gene   UCSC   Ensembl
• Aliases: CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP-3, TIP3
• Gene name: suppressor of cytokine signaling 1
• Alternate names: suppressor of cytokine signaling 1, JAK binding protein, STAT induced SH3 protein 1, STAT-induced STAT inhibitor 1, Tec-interacting protein 3, cytokine-inducible SH2 protein 1,
• Gene location: 16p13.13 (52287557: 52295256)     Exons: 5     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be ind
• OMIM: 603597

Protein Summary

• Protein general information: O15524  
  • Name: Suppressor of cytokine signaling 1 (SOCS 1) (JAK binding protein) (JAB) (STAT induced STAT inhibitor 1) (SSI 1) (Tec interacting protein 3) (TIP 3)
  • Length: 211  
  • Mass: 23551
  • Tissue specificity: Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes.
• Sequence:

  MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRASALLD
  ACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFEL
  LEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI

• Structural information:
  • Protein Domains: (79..17-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (161..21-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR000980  IPR036860  IPR028411  IPR035861  IPR001496   IPR036036  
  • Prosite: PS50001 PS50225
  • CDD: cd10382
  • DIP: 29662
  • STRING: ENSP00000329418
• Other Databases: GeneCards:  SOCS1  Malacards:  SOCS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0043377	negative regulation of CD8-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0060334	regulation of interferon-gamma-mediated signaling pathway	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0004860	protein kinase inhibitor activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0060334	regulation of interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038111	interleukin-7-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0010533	regulation of activation of Janus kinase activity	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0042509	regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0019210	kinase inhibitor activity	IEA	molecular function
GO:0042532	negative regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0043377	negative regulation of CD8-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0046425	regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IMP	biological process
GO:0045591	positive regulation of regulatory T cell differentiation	IMP	biological process
GO:0042532	negative regulation of tyrosine phosphorylation of STAT protein	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0033673	negative regulation of kinase activity	IEA	biological process
GO:0033673	negative regulation of kinase activity	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0019210	kinase inhibitor activity	ISS	molecular function
GO:0005159	insulin-like growth factor receptor binding	IPI	molecular function
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	NAS	biological process
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	ISS	biological process
GO:0019221	cytokine-mediated signaling pathway	ISS	biological process
GO:0042532	negative regulation of tyrosine phosphorylation of STAT protein	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0001932	regulation of protein phosphorylation	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa04120	Ubiquitin mediated proteolysis
hsa04630	JAK-STAT signaling pathway
hsa04910	Insulin signaling pathway
hsa04380	Osteoclast differentiation
hsa04935	Growth hormone synthesis, secretion and action
hsa05145	Toxoplasmosis
hsa04917	Prolactin signaling pathway
hsa04930	Type II diabetes mellitus

Diseases

Associated diseases	References
Ductal carcinoma in situ	PMID:12888825
Prostate cancer	PMID:16458425
urinary bladder cancer	PMID:16242928
urinary bladder cancer	PMID:17522834
invasive ductal carcinoma	PMID:12888825
ovarian carcinoma	PMID:15361843
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881