• Gene id: 8648

Gene Summary

• Gene Symbol: NCOA1   Gene   UCSC   Ensembl
• Aliases: F-SRC-1, KAT13A, RIP160, SRC1, bHLHe42, bHLHe74
• Gene name: nuclear receptor coactivator 1
• Alternate names: nuclear receptor coactivator 1, Hin-2 protein, class E basic helix-loop-helix protein 74, renal carcinoma antigen NY-REN-52, steroid receptor coactivator-1,
• Gene location: 2p23.3 (24491253: 24770701)     Exons: 26     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene acts as a transcriptional coactivator for steroid and nuclear hormone receptors. It is a member of the p160/steroid receptor coactivator (SRC) family and like other family members has histone acetyltransferase activity and
• OMIM: 602691

Protein Summary

• Protein general information: Q15788  
  • Name: Nuclear receptor coactivator 1 (NCoA 1) (EC 2.3.1.48) (Class E basic helix loop helix protein 74) (bHLHe74) (Protein Hin 2) (RIP160) (Renal carcinoma antigen NY REN 52) (Steroid receptor coactivator 1) (SRC 1)
  • Length: 1441  
  • Mass: 156757
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKILKKTVD
  QIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEE
  LMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFT
  VSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
  QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQD
  DTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINRQQSSDLHSSSHSNSSNSQGSFGCSPGSQIV
  ANVALNQGQASSQSSNPSLNLNNSPMEGTGISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSA
  CNNNNRSYSNIPVTSLQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
  SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSNSASANSSGGS
  CPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVSVTGQVQGNSSIKLELDASKKKESKDHQLLR
  YLLDKDEKDLRSTPNLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAA
  QLPGLCETDRMDGAVTSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN
  QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPP
  QQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGTMPVQVTPPRGAFSPGMGMQPRQTLNRPPAA
  PNQLRLQLQQRLQGQQQLIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQ
  LIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLAN
  RNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPAS
  GYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNT
  VCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQ
  TPQAQQKSLLQQLLTE

• Structural information:
  • Protein Domains: (23..8-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981-)
    (109..18-)
    (/note="PAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00140"-)
  • Interpro: IPR011598  IPR010011  IPR036638  IPR028819  IPR009110   IPR014920  IPR037077  IPR017426  IPR000014  IPR035965  IPR013767  IPR014935  
  • Prosite: PS50888 PS50112
  • CDD: cd00083 cd00130
  • PDB: 1FM6 1FM9 1K4W 1K74 1K7L 1KV6 1N4H 1NQ7 1NRL 1P8D 1PZL 1RDT 1TFC 1U3R 1U3S 1X76 1X78 1X7B 1X7J 1XIU 1XV9 1XVP 1YY4 1YYE 1ZAF 2A3I 2C52 2FVJ 2GTK 2HBH 2HC4 2HCD 2HFP 2NPA 2NV7 2P54 2PRG 3BEJ 3BQD 3CTB 3CWD 3DCT 3DCU 3DR1 3ET1 3ET3 3FEI 3FEJ 3FUR 3FXV 3G8I 3G9E 3GYT 3GYU 3H0A 3HC5 3HC6 3HVL 3IPQ 3IPS 3IPU 3KMR 3LMP 3OK
  • PDBsum: 1FM6 1FM9 1K4W 1K74 1K7L 1KV6 1N4H 1NQ7 1NRL 1P8D 1PZL 1RDT 1TFC 1U3R 1U3S 1X76 1X78 1X7B 1X7J 1XIU 1XV9 1XVP 1YY4 1YYE 1ZAF 2A3I 2C52 2FVJ 2GTK 2HBH 2HC4 2HCD 2HFP 2NPA 2NV7 2P54 2PRG 3BEJ 3BQD 3CTB 3CWD 3DCT 3DCU 3DR1 3ET1 3ET3 3FEI 3FEJ 3FUR 3FXV 3G8I 3G9E 3GYT 3GYU 3H0A 3HC5 3HC6 3HVL 3IPQ 3IPS 3IPU 3KMR 3LMP 3OK
  • DIP: 30877
  • STRING: ENSP00000385216
• Other Databases: GeneCards:  NCOA1  Malacards:  NCOA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0035257	nuclear hormone receptor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016922	nuclear receptor binding	IBA	molecular function
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0035257	nuclear hormone receptor binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0000435	positive regulation of transcription from RNA polymerase II promoter by galactose	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0016922	nuclear receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035257	nuclear hormone receptor binding	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060179	male mating behavior	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0032570	response to progesterone	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0021854	hypothalamus development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:2001141	regulation of RNA biosynthetic process	IEA	biological process
GO:2001038	regulation of cellular response to drug	IEA	biological process
GO:0060713	labyrinthine layer morphogenesis	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0046965	retinoid X receptor binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045925	positive regulation of female receptivity	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0044849	estrous cycle	IEA	biological process
GO:0042974	retinoic acid receptor binding	IEA	molecular function
GO:0033142	progesterone receptor binding	IEA	molecular function
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0030331	estrogen receptor binding	IEA	molecular function
GO:0021987	cerebral cortex development	IEA	biological process
GO:0016922	nuclear receptor binding	IEA	molecular function
GO:0009725	response to hormone	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1904017	cellular response to Thyroglobulin triiodothyronine	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043967	histone H4 acetylation	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0002155	regulation of thyroid hormone mediated signaling pathway	IEA	biological process
GO:0000435	positive regulation of transcription from RNA polymerase II promoter by galactose	IEA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016922	nuclear receptor binding	IPI	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	NAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IMP	cellular component
GO:0017162	aryl hydrocarbon receptor binding	IPI	molecular function
GO:0006351	transcription, DNA-templated	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05224	Breast cancer
hsa04919	Thyroid hormone signaling pathway
hsa04915	Estrogen signaling pathway

Diseases

Associated diseases	References
Prostate cancer	PMID:14871982
Endometrial carcinoma	PMID:14751175
Breast carcinoma	PMID:17902051
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq