• Gene id: 8646

Gene Summary

• Gene Symbol: CHRD   Gene   UCSC   Ensembl
• Gene name: chordin
• Alternate names: chordin,
• Gene location: 3q27.1 (184380072: 184390738)     Exons: 24     NC_000003.12
• Gene summary(Entrez): This gene encodes a secreted protein that dorsalizes early vertebrate embryonic tissues by binding to ventralizing TGF-beta-like bone morphogenetic proteins and sequestering them in latent complexes. The encoded protein may also have roles in organogenesi
• OMIM: 613302

Protein Summary

• Protein general information: Q9H2X0  
  • Name: Chordin
  • Length: 955  
  • Mass: 102032
  • Tissue specificity: Expressed at the highest level in liver.
• Sequence:

  MPSLPAPPAPLLLLGLLLLGSRPARGAGPEPPVLPIRSEKEPLPVRGAAGCTFGGKVYALDETWHPDLGEPFGVM
  RCVLCACEAPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGHCCQTCPQERSSSERQPSGLSFEYPRDPEHR
  SYSDRGEPGAEERARGDGHTDFVALLTGPRSQAVARARVSLLRSSLRFSISYRRLDRPTRIRFSDSNGSVLFEHP
  AAPTQDGLVCGVWRAVPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAAETFSAILTLEGPPQQGVGGI
  TLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQANVSAQEPGFAEVLPNLTVQEMDWLV
  LGELQMALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQTGAAGSASLTLLGNGSLIYQVQVVGTSSEV
  VAMTLETKPQRRDQRTVLCHMAGLQPGGHTAVGICPGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVAALPYC
  GHSARHDTLPVPLAGALVLPPVKSQAAGHAWLSLDTHCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLK
  GFYGSEAQGVVKDLEPELLRHLAKGMASLMITTKGSPRGELRGQVHIANQCEVGGLRLEAAGAEGVRALGAPDTA
  SAAPPVVPGLPALAPAKPGGPGRPRDPNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPH
  PVQAPDQCCPVCPEKQDVRDLPGLPRSRDPGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHC
  EKVQCPRLACAQPVRVNPTDCCKQCPVGSGAHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITC
  RCGAGVPHCERDDCSLPLSCGSGKESRCCSRCTAHRRPAPETRTDPELEKEAEGS

• Structural information:
  • Protein Domains: (49..12-)
    (/note="VWFC-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220-)
    (168..27-)
    (/note="CHRD-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00230-)
    (279..40-)
    (/note="CHRD-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00230-)
    (-)
  • Interpro: IPR016353  IPR010895  IPR001007  
  • Prosite: PS50933 PS01208 PS50184
  • DIP: 48857
  • STRING: ENSP00000204604
• Other Databases: GeneCards:  CHRD  Malacards:  CHRD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045545	syndecan binding	IEA	molecular function
GO:0009953	dorsal/ventral pattern formation	IEA	biological process
GO:0007417	central nervous system development	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001702	gastrulation with mouth forming second	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0007389	pattern specification process	IEA	biological process
GO:0001707	mesoderm formation	IEA	biological process
GO:0019955	cytokine binding	NAS	molecular function
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0005615	extracellular space	NAS	cellular component
GO:0021919	BMP signaling pathway involved in spinal cord dorsal/ventral patterning	IMP	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	IMP	biological process
GO:0030514	negative regulation of BMP signaling pathway	IMP	biological process
GO:0033504	floor plate development	TAS	biological process
GO:0045668	negative regulation of osteoblast differentiation	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001501	skeletal system development	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq