• Gene id: 8644

Gene Summary

• Gene Symbol: AKR1C3   Gene   UCSC   Ensembl
• Aliases: DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS
• Gene name: aldo-keto reductase family 1 member C3
• Alternate names: aldo-keto reductase family 1 member C3, 3-alpha hydroxysteroid dehydrogenase, type II, 3-alpha-HSD type II, brain, chlordecone reductase homolog HAKRb, dihydrodiol dehydrogenase 3, dihydrodiol dehydrogenase X, indanol dehydrogenase, prostaglandin F syntha,
• Gene location: 10p15.1 (5048765: 5107685)     Exons: 10     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as
• OMIM: 603966

Protein Summary

• Protein general information: P42330  
  • Name: Aldo keto reductase family 1 member C3 (EC 1. . . ) (17 beta hydroxysteroid dehydrogenase type 5) (17 beta HSD 5) (3 alpha HSD type II, brain) (3 alpha hydroxysteroid dehydrogenase type 2) (3 alpha HSD type 2) (EC 1.1.1.357) (Chlordecone reductase homolog
  • Length: 323  
  • Mass: 36,853
• Sequence:

  MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK
  REDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEA
  MEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDK
  RWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
  RNLHYFNSDSFASHPNYPYSDEY

• Structural information:
  • Interpro: IPR018170  IPR020471  IPR023210  IPR036812  
  • Prosite: PS00798 PS00062 PS00063
  • CDD: cd06660
  • PDB: 1RY0 1RY8 1S1P 1S1R 1S2A 1S2C 1XF0 1ZQ5 2F38 2FGB 3R43 3R58 3R6I 3R7M 3R8G 3R8H 3R94 3UFY 3UG8 3UGR 3UWE 4DBS 4DBU 4DBW 4DZ5 4FA3 4FAL 4FAM 4H7C 4HMN 4WDT 4WDU 4WDW 4WDX 4WRH 4XVD 4XVE 4YVV 4YVX 4ZFC 5HNT 5HNU 5JM5
  • PDBsum: 1RY0 1RY8 1S1P 1S1R 1S2A 1S2C 1XF0 1ZQ5 2F38 2FGB 3R43 3R58 3R6I 3R7M 3R8G 3R8H 3R94 3UFY 3UG8 3UGR 3UWE 4DBS 4DBU 4DBW 4DZ5 4FA3 4FAL 4FAM 4H7C 4HMN 4WDT 4WDU 4WDW 4WDX 4WRH 4XVD 4XVE 4YVV 4YVX 4ZFC 5HNT 5HNU 5JM5
  • STRING: ENSP00000369927
• Other Databases: GeneCards:  AKR1C3  Malacards:  AKR1C3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000060	protein import into nucleus, translocation	IDA	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0001758	retinal dehydrogenase activity	IDA	molecular function
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IDA	molecular function
GO:0004033	aldo-keto reductase (NADP) activity	TAS	molecular function
GO:0004033	aldo-keto reductase (NADP) activity	TAS	molecular function
GO:0004745	retinol dehydrogenase activity	IDA	molecular function
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006693	prostaglandin metabolic process	IEP	biological process
GO:0006693	prostaglandin metabolic process	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007584	response to nutrient	IEP	biological process
GO:0008202	steroid metabolic process	IEP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008584	male gonad development	IEP	biological process
GO:0009267	cellular response to starvation	IEP	biological process
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0016488	farnesol catabolic process	IDA	biological process
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0018636	phenanthrene 9,10-monooxygenase activity	IDA	molecular function
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0030216	keratinocyte differentiation	IEP	biological process
GO:0034614	cellular response to reactive oxygen species	IDA	biological process
GO:0035410	dihydrotestosterone 17-beta-dehydrogenase activity	IDA	molecular function
GO:0036130	prostaglandin H2 endoperoxidase reductase activity	TAS	molecular function
GO:0036131	prostaglandin D2 11-ketoreductase activity	TAS	molecular function
GO:0042448	progesterone metabolic process	IDA	biological process
GO:0042572	retinol metabolic process	IEA	biological process
GO:0042574	retinal metabolic process	IDA	biological process
GO:0044259	multicellular organismal macromolecule metabolic process	IEP	biological process
GO:0044597	daunorubicin metabolic process	IMP	biological process
GO:0044598	doxorubicin metabolic process	IMP	biological process
GO:0045550	geranylgeranyl reductase activity	IDA	molecular function
GO:0045703	ketoreductase activity	IDA	molecular function
GO:0047017	prostaglandin-F synthase activity	IEA	molecular function
GO:0047020	15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity	IDA	molecular function
GO:0047023	androsterone dehydrogenase activity	IDA	molecular function
GO:0047035	testosterone dehydrogenase (NAD+) activity	IEA	molecular function
GO:0047045	testosterone 17-beta-dehydrogenase (NADP+) activity	IEA	molecular function
GO:0047086	ketosteroid monooxygenase activity	IDA	molecular function
GO:0047115	trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity	IEA	molecular function
GO:0047718	indanol dehydrogenase activity	IEA	molecular function
GO:0047787	delta4-3-oxosteroid 5beta-reductase activity	IDA	molecular function
GO:0048385	regulation of retinoic acid receptor signaling pathway	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0052650	NADP-retinol dehydrogenase activity	TAS	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	TAS	biological process
GO:0061370	testosterone biosynthetic process	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070293	renal absorption	NAS	biological process
GO:0071276	cellular response to cadmium ion	IDA	biological process
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0071379	cellular response to prostaglandin stimulus	IDA	biological process
GO:0071384	cellular response to corticosteroid stimulus	IDA	biological process
GO:0071395	cellular response to jasmonic acid stimulus	IDA	biological process
GO:0071799	cellular response to prostaglandin D stimulus	IDA	biological process
GO:1900053	negative regulation of retinoic acid biosynthetic process	IDA	biological process
GO:2000224	regulation of testosterone biosynthetic process	IMP	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0000060	protein import into nucleus, translocation	IDA	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0001758	retinal dehydrogenase activity	IDA	molecular function
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IDA	molecular function
GO:0004033	aldo-keto reductase (NADP) activity	TAS	molecular function
GO:0004033	aldo-keto reductase (NADP) activity	TAS	molecular function
GO:0004745	retinol dehydrogenase activity	IDA	molecular function
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006693	prostaglandin metabolic process	IEP	biological process
GO:0006693	prostaglandin metabolic process	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007584	response to nutrient	IEP	biological process
GO:0008202	steroid metabolic process	IEP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008584	male gonad development	IEP	biological process
GO:0009267	cellular response to starvation	IEP	biological process
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0016488	farnesol catabolic process	IDA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0018636	phenanthrene 9,10-monooxygenase activity	IDA	molecular function
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0030216	keratinocyte differentiation	IEP	biological process
GO:0034614	cellular response to reactive oxygen species	IDA	biological process
GO:0035410	dihydrotestosterone 17-beta-dehydrogenase activity	IDA	molecular function
GO:0036130	prostaglandin H2 endoperoxidase reductase activity	TAS	molecular function
GO:0036131	prostaglandin D2 11-ketoreductase activity	IEA	molecular function
GO:0036131	prostaglandin D2 11-ketoreductase activity	TAS	molecular function
GO:0042448	progesterone metabolic process	IDA	biological process
GO:0042572	retinol metabolic process	IEA	biological process
GO:0042574	retinal metabolic process	IDA	biological process
GO:0044259	multicellular organismal macromolecule metabolic process	IEP	biological process
GO:0044597	daunorubicin metabolic process	IMP	biological process
GO:0044598	doxorubicin metabolic process	IMP	biological process
GO:0045550	geranylgeranyl reductase activity	IDA	molecular function
GO:0045703	ketoreductase activity	IDA	molecular function
GO:0047017	prostaglandin-F synthase activity	IEA	molecular function
GO:0047020	15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity	IDA	molecular function
GO:0047023	androsterone dehydrogenase activity	IDA	molecular function
GO:0047035	testosterone dehydrogenase (NAD+) activity	IEA	molecular function
GO:0047045	testosterone 17-beta-dehydrogenase (NADP+) activity	IEA	molecular function
GO:0047086	ketosteroid monooxygenase activity	IDA	molecular function
GO:0047115	trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity	IEA	molecular function
GO:0047718	indanol dehydrogenase activity	IEA	molecular function
GO:0047787	delta4-3-oxosteroid 5beta-reductase activity	IDA	molecular function
GO:0048385	regulation of retinoic acid receptor signaling pathway	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0052650	NADP-retinol dehydrogenase activity	TAS	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	TAS	biological process
GO:0061370	testosterone biosynthetic process	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070293	renal absorption	NAS	biological process
GO:0071276	cellular response to cadmium ion	IDA	biological process
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0071379	cellular response to prostaglandin stimulus	IDA	biological process
GO:0071384	cellular response to corticosteroid stimulus	IDA	biological process
GO:0071395	cellular response to jasmonic acid stimulus	IDA	biological process
GO:0071799	cellular response to prostaglandin D stimulus	IDA	biological process
GO:1900053	negative regulation of retinoic acid biosynthetic process	IDA	biological process
GO:2000224	regulation of testosterone biosynthetic process	IMP	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0000060	protein import into nucleus, translocation	IDA	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0001758	retinal dehydrogenase activity	IDA	molecular function
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IDA	molecular function
GO:0004033	aldo-keto reductase (NADP) activity	TAS	molecular function
GO:0004033	aldo-keto reductase (NADP) activity	TAS	molecular function
GO:0004745	retinol dehydrogenase activity	IDA	molecular function
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006693	prostaglandin metabolic process	IEP	biological process
GO:0006693	prostaglandin metabolic process	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007584	response to nutrient	IEP	biological process
GO:0008202	steroid metabolic process	IEP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008584	male gonad development	IEP	biological process
GO:0009267	cellular response to starvation	IEP	biological process
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0016488	farnesol catabolic process	IDA	biological process
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0018636	phenanthrene 9,10-monooxygenase activity	IDA	molecular function
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0030216	keratinocyte differentiation	IEP	biological process
GO:0034614	cellular response to reactive oxygen species	IDA	biological process
GO:0035410	dihydrotestosterone 17-beta-dehydrogenase activity	IDA	molecular function
GO:0036130	prostaglandin H2 endoperoxidase reductase activity	TAS	molecular function
GO:0036131	prostaglandin D2 11-ketoreductase activity	TAS	molecular function
GO:0042448	progesterone metabolic process	IDA	biological process
GO:0042574	retinal metabolic process	IDA	biological process
GO:0044259	multicellular organismal macromolecule metabolic process	IEP	biological process
GO:0044597	daunorubicin metabolic process	IMP	biological process
GO:0044598	doxorubicin metabolic process	IMP	biological process
GO:0045550	geranylgeranyl reductase activity	IDA	molecular function
GO:0045703	ketoreductase activity	IDA	molecular function
GO:0047020	15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity	IDA	molecular function
GO:0047023	androsterone dehydrogenase activity	IDA	molecular function
GO:0047086	ketosteroid monooxygenase activity	IDA	molecular function
GO:0047787	delta4-3-oxosteroid 5beta-reductase activity	IDA	molecular function
GO:0048385	regulation of retinoic acid receptor signaling pathway	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0052650	NADP-retinol dehydrogenase activity	TAS	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	TAS	biological process
GO:0061370	testosterone biosynthetic process	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070293	renal absorption	NAS	biological process
GO:0071276	cellular response to cadmium ion	IDA	biological process
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0071379	cellular response to prostaglandin stimulus	IDA	biological process
GO:0071384	cellular response to corticosteroid stimulus	IDA	biological process
GO:0071395	cellular response to jasmonic acid stimulus	IDA	biological process
GO:0071799	cellular response to prostaglandin D stimulus	IDA	biological process
GO:1900053	negative regulation of retinoic acid biosynthetic process	IDA	biological process
GO:2000224	regulation of testosterone biosynthetic process	IMP	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04913	Ovarian steroidogenesis

Diseases

Associated diseases	References
Cancer	GAD: 19574343
Cancer (esophageal)	GAD: 20453000
Cancer (leukemia)	GAD: 18339682
Cancer (lung)	GAD: 15781210
Cancer (lymphoma)	GAD: 17149600
Cancer (bladder)	GAD: 18632753
Cancer (prostate)	GAD: 17220347
Cancer (breast)	GAD: 19460435
Hyperandrogenism	GAD: 18692800
Obesity	GAD: 20734064
Polycystic ovary syndrome (PCOS)	GAD: 17940109
Polycystic ovary syndrome (PCOS)	GAD: 18692800
Precocious puberty	GAD: 17583494
Female infertility	INFBASE: 18692800
Polycystic ovary syndrome (PCOS)	INFBASE: 21039282
Endometriosis	INFBASE: 25446850
Ovarian endometriosis	INFBASE: 21232532
Male pseudohermaphroditism	MIK: 9758445
Male factor infertility	MIK: 9758445
Female infertility	INFBASE: 16263811
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male pseudohermaphroditism (MPH)	MIK: 9758445
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
9758445	Male pseudohermaphroditism (MPH)	R80W in exon 3 of the 17beta-HSD3 gene		1 46, XY new-born diagnosed as having MPH	Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R