• Gene id: 8638

Gene Summary

• Gene Symbol: OASL   Gene   UCSC   Ensembl
• Aliases: OASL1, OASLd, TRIP-14, TRIP14, p59 OASL, p59-OASL, p59OASL
• Gene name: 2'-5'-oligoadenylate synthetase like
• Alternate names: 2'-5'-oligoadenylate synthase-like protein, 2'-5'-OAS-RP, 2'-5'-OAS-related protein, 59 kDa 2'-5'-oligoadenylate synthase-like protein, 59 kDa 2'-5'-oligoadenylate synthetase-like protein, TR-interacting protein 14, thyroid receptor-interacting protein 14,
• Gene location: 12q24.31 (152243631: 152465779)     Exons: 20     NC_000003.12
• OMIM: 603281

Protein Summary

• Protein general information: Q15646  
  • Name: 2' 5' oligoadenylate synthase like protein (2' 5' OAS related protein) (2' 5' OAS RP) (59 kDa 2' 5' oligoadenylate synthase like protein) (Thyroid receptor interacting protein 14) (TR interacting protein 14) (TRIP 14) (p59 OASL) (p59OASL)
  • Length: 514  
  • Mass: 59226
  • Tissue specificity: Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis.
• Sequence:

  MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVRVLKVVKVGSFGNGTV
  LRSTREVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLDLGLEDLRMEQRVPDALVFTIQTRGTAEPIT
  VTIVPAYRALGPSLPNSQPPPEVYVSLIKACGGPGNFCPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVKARS
  PRANLPPLYALELLTIYAWEMGTEEDENFMLDEGFTTVMDLLLEYEVICIYWTKYYTLHNAIIEDCVRKQLKKER
  PIILDPADPTLNVAEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKRARDIHLTVEQRGYPDFNLIVNPYEP
  IRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFSHTHIYLLETIPSEIQVFVKNPDGGSYAYAI
  NPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLILSKKKGEALFPAS

• Structural information:
  • Protein Domains: (354..43-)
    (/note="Ubiquitin-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214-)
    (434..50-)
    (/note="Ubiquitin-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR006117  IPR006116  IPR018952  IPR038121  IPR026774   IPR000626  IPR029071  
  • Prosite: PS00832 PS00833 PS50152 PS50053
  • PDB: 1WH3 4XQ7
  • PDBsum: 1WH3 4XQ7
  • STRING: ENSP00000257570
• Other Databases: GeneCards:  OASL  Malacards:  OASL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0045071	negative regulation of viral genome replication	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0060700	regulation of ribonuclease activity	IBA	biological process
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0001730	2'-5'-oligoadenylate synthetase activity	IDA	NOT|molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051607	defense response to virus	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0046966	thyroid hormone receptor binding	TAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881