• Gene id: 8635

Gene Summary

• Gene Symbol: RNASET2   Gene   UCSC   Ensembl
• Aliases: RNASE6PL, bA514O12.3
• Gene name: ribonuclease T2
• Alternate names: ribonuclease T2, ribonuclease 6,
• Gene location: 6q27 (166956588: 166929508)     Exons: 10     NC_000006.12
• Gene summary(Entrez): This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. [provided by RefSeq, Jul 2008
• OMIM: 612944

Protein Summary

• Protein general information: O00584  
  • Name: Ribonuclease T2 (EC 3.1.27. ) (Ribonuclease 6)
  • Length: 256  
  • Mass: 29,481
• Sequence:

  MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGC
  NRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSV
  LLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQE
  VWLANGAAESRGLRVCEDGPVFYPPPKKTKH

• Structural information:
  • Interpro: IPR033697  IPR001568  IPR036430  IPR018188  IPR033130  
  • Prosite: PS00530 PS00531
  • CDD: cd01061
  • PDB: 3T0O
  • PDBsum: 3T0O
  • STRING: ENSP00000422846
• Other Databases: GeneCards:  RNASET2  Malacards:  RNASET2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IEA	molecular function
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0006401	RNA catabolic process	IDA	biological process
GO:0033897	ribonuclease T2 activity	IEA	molecular function
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0004540	ribonuclease activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0006401	RNA catabolic process	IDA	biological process
GO:0006401	RNA catabolic process	TAS	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0033897	ribonuclease T2 activity	IEA	molecular function
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0004540	ribonuclease activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0006401	RNA catabolic process	IDA	biological process
GO:0006401	RNA catabolic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Graves disease	GAD: 21841780
Crohn's disease	GAD: 20601676
Leukoencephalopathy	OMIM: 612944
Asthenozoospermia	MIK: 23258633
Vitiligo	GAD: 20526339
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 23258633
Cryptorchidism	MIK: 28606200
Reduced sperm motility	MIK: 29581387
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23258633	Asthenozoospermia			149 (67 asthenozoospermia individuals, 59 fertile individuals)	Male infertility	RNASET2
29581387	Reduced sperm motility			205 semen samples from both asthenozoospermia patients, normozoospermia individuals	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray