• Gene id: 8633

Gene Summary

• Gene Symbol: UNC5C   Gene   UCSC   Ensembl
• Aliases: UNC5H3
• Gene name: unc-5 netrin receptor C
• Alternate names: netrin receptor UNC5C, protein unc-5 homolog 3, protein unc-5 homolog C, unc-5 homolog 3, unc-5 homolog C, unc5 (C.elegans homolog) c,
• Gene location: 4q22.3 (95549209: 95162503)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as rep
• OMIM: 603610

Protein Summary

• Protein general information: O95185  
  • Name: Netrin receptor UNC5C (Protein unc 5 homolog 3) (Protein unc 5 homolog C)
  • Length: 931  
  • Mass: 103146
  • Tissue specificity: Mainly expressed in brain (PubMed
• Sequence:

  MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEPLPHFLIEPEEAYIVK
  NKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSA
  GTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLI
  IKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
  GQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAPDSD
  DVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYR
  GPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQ
  TDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGAL
  LTRPVVLTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGHSTT
  KAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAH
  SLWKSKLLAKYQEIPFYHVWSGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLP
  LLDPANTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQN
  FPDGNLSMLAAVLEEMGRHETVVSLAAEGQY

• Structural information:
  • Protein Domains: (62..15-)
    (/note="Ig-like-)
    (161..25-)
    (/note="Ig-like-C2-type)
    (260..31-)
    1 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210-)
    (316..36-)
    2 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0021-)
  • Interpro: IPR011029  IPR000488  IPR042154  IPR007110  IPR036179   IPR013783  IPR013098  IPR003599  IPR003598  IPR000884  IPR036383  IPR037936  IPR033772  IPR000906  
  • Prosite: PS50835 PS50092 PS51145
  • CDD: cd08799
  • DIP: 46276
  • STRING: ENSP00000406022
• Other Databases: GeneCards:  UNC5C  Malacards:  UNC5C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005042	netrin receptor activity	IBA	molecular function
GO:0007411	axon guidance	IBA	biological process
GO:0005042	netrin receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038007	netrin-activated signaling pathway	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005042	netrin receptor activity	TAS	molecular function
GO:0007411	axon guidance	TAS	biological process
GO:0007420	brain development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030334	regulation of cell migration	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0015631	tubulin binding	IEA	molecular function
GO:0005043	netrin receptor activity involved in chemorepulsion	IEA	molecular function
GO:0005042	netrin receptor activity	IEA	molecular function
GO:0061643	chemorepulsion of axon	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0038007	netrin-activated signaling pathway	IEA	biological process
GO:0033564	anterior/posterior axon guidance	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1990791	dorsal root ganglion development	IDA	biological process
GO:0030175	filopodium	ISS	cellular component
GO:0015631	tubulin binding	IPI	molecular function
GO:0005043	netrin receptor activity involved in chemorepulsion	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061643	chemorepulsion of axon	ISS	biological process
GO:0030426	growth cone	ISS	cellular component
GO:0030027	lamellipodium	ISS	cellular component
GO:0019901	protein kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881