• Gene id: 8626

Gene Summary

• Gene Symbol: TP63   Gene   UCSC   Ensembl
• Aliases: AIS, B(p51A), B(p51B), EEC3, KET, LMS, NBP, OFC8, RHS, SHFM4, TP53CP, TP53L, TP73L, p40, p51, p53CP, p63, p73H, p73L
• Gene name: tumor protein p63
• Alternate names: tumor protein 63, amplified in squamous cell carcinoma, chronic ulcerative stomatitis protein, keratinocyte transcription factor KET, transformation-related protein 63, tumor protein p53-competing protein,
• Gene location: 3q28 (189596745: 189897278)     Exons: 17     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gen
• OMIM: 603273

Protein Summary

• Protein general information: Q9H3D4  
  • Name: Tumor protein 63 (p63) (Chronic ulcerative stomatitis protein) (CUSP) (Keratinocyte transcription factor KET) (Transformation related protein 63) (TP63) (Tumor protein p73 like) (p73L) (p40) (p51)
  • Length: 680  
  • Mass: 76,785
• Sequence:

  MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLN
  FVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYA
  QPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVI
  RAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
  TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTK
  RPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQ
  TSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQAL
  PPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
  ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRI
  KEEGE

• Structural information:
  • Protein Domains: SAM. (541-607)
  • Interpro: IPR008967  IPR012346  IPR011615  IPR036674  IPR010991   IPR002117  IPR001660  IPR013761  IPR032645  IPR037611  
  • Prosite: PS00348
  • CDD: cd08367 cd09572
  • PDB: 1RG6 2NB1 2RMN 2Y9T 2Y9U 3QYM 3QYN 3US0 3US1 3US2 3ZY0 3ZY1 4A9Z
  • PDBsum: 1RG6 2NB1 2RMN 2Y9T 2Y9U 3QYM 3QYN 3US0 3US1 3US2 3ZY0 3ZY1 4A9Z
  • DIP: 29588
  • STRING: ENSP00000264731
• Other Databases: GeneCards:  TP63  Malacards:  TP63

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IBA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000989	transcription factor activity, transcription factor binding	IEA	molecular function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	IEA	molecular function
GO:0001302	replicative cell aging	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0001736	establishment of planar polarity	IEA	biological process
GO:0002039	p53 binding	IBA	molecular function
GO:0002053	positive regulation of mesenchymal cell proliferation	IEA	biological process
GO:0002064	epithelial cell development	IEA	biological process
GO:0003677	DNA binding	NAS	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0003684	damaged DNA binding	IBA	molecular function
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor complex	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006338	chromatin remodeling	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IBA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007499	ectoderm and mesoderm interaction	IEA	biological process
GO:0009954	proximal/distal pattern formation	IEA	biological process
GO:0010165	response to X-ray	IBA	biological process
GO:0010259	multicellular organism aging	IEA	biological process
GO:0010332	response to gamma radiation	IBA	biological process
GO:0010481	epidermal cell division	IEA	biological process
GO:0010482	regulation of epidermal cell division	ISS	biological process
GO:0010838	positive regulation of keratinocyte proliferation	IEA	biological process
GO:0030216	keratinocyte differentiation	IEA	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0030859	polarized epithelial cell differentiation	IEA	biological process
GO:0031069	hair follicle morphogenesis	IEA	biological process
GO:0031571	mitotic G1 DNA damage checkpoint	IBA	biological process
GO:0034644	cellular response to UV	IBA	biological process
GO:0036342	post-anal tail morphogenesis	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043523	regulation of neuron apoptotic process	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0043589	skin morphogenesis	IEA	biological process
GO:0043616	keratinocyte proliferation	IEA	biological process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular function
GO:0045617	negative regulation of keratinocyte differentiation	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0045747	positive regulation of Notch signaling pathway	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048485	sympathetic nervous system development	IEA	biological process
GO:0048745	smooth muscle tissue development	IEA	biological process
GO:0048807	female genitalia morphogenesis	IEA	biological process
GO:0050699	WW domain binding	IPI	molecular function
GO:0051289	protein homotetramerization	IPI	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0060157	urinary bladder development	IEA	biological process
GO:0060197	cloacal septation	IEA	biological process
GO:0060513	prostatic bud formation	IEA	biological process
GO:0060529	squamous basal epithelial stem cell differentiation involved in prostate gland acinus development	IEA	biological process
GO:0061436	establishment of skin barrier	ISS	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:1902808	positive regulation of cell cycle G1/S phase transition	IMP	biological process
GO:2000271	positive regulation of fibroblast apoptotic process	IDA	biological process
GO:2000381	negative regulation of mesoderm development	IEA	biological process
GO:2000773	negative regulation of cellular senescence	IMP	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IBA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000989	transcription factor activity, transcription factor binding	IEA	molecular function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding	IEA	molecular function
GO:0001302	replicative cell aging	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0001736	establishment of planar polarity	IEA	biological process
GO:0001738	morphogenesis of a polarized epithelium	IEA	biological process
GO:0001942	hair follicle development	IEA	biological process
GO:0002039	p53 binding	IBA	molecular function
GO:0002053	positive regulation of mesenchymal cell proliferation	IEA	biological process
GO:0002064	epithelial cell development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	NAS	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003684	damaged DNA binding	IBA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor complex	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006338	chromatin remodeling	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IBA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007389	pattern specification process	IEA	biological process
GO:0007499	ectoderm and mesoderm interaction	IEA	biological process
GO:0007569	cell aging	IEA	biological process
GO:0008544	epidermis development	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0009954	proximal/distal pattern formation	IEA	biological process
GO:0010165	response to X-ray	IBA	biological process
GO:0010259	multicellular organism aging	IEA	biological process
GO:0010332	response to gamma radiation	IBA	biological process
GO:0010481	epidermal cell division	IEA	biological process
GO:0010482	regulation of epidermal cell division	IEA	biological process
GO:0010482	regulation of epidermal cell division	ISS	biological process
GO:0010838	positive regulation of keratinocyte proliferation	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0030216	keratinocyte differentiation	IEA	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0030850	prostate gland development	IEA	biological process
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0030859	polarized epithelial cell differentiation	IEA	biological process
GO:0031069	hair follicle morphogenesis	IEA	biological process
GO:0031571	mitotic G1 DNA damage checkpoint	IBA	biological process
GO:0032502	developmental process	IEA	biological process
GO:0034644	cellular response to UV	IBA	biological process
GO:0036342	post-anal tail morphogenesis	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0043234	protein complex	IEA	cellular component
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043523	regulation of neuron apoptotic process	IBA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0043589	skin morphogenesis	IEA	biological process
GO:0043616	keratinocyte proliferation	IEA	biological process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular function
GO:0045617	negative regulation of keratinocyte differentiation	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0045747	positive regulation of Notch signaling pathway	IEA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048485	sympathetic nervous system development	IEA	biological process
GO:0048646	anatomical structure formation involved in morphogenesis	IEA	biological process
GO:0048745	smooth muscle tissue development	IEA	biological process
GO:0048807	female genitalia morphogenesis	IEA	biological process
GO:0050699	WW domain binding	IPI	molecular function
GO:0051262	protein tetramerization	IEA	biological process
GO:0051289	protein homotetramerization	IPI	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0060157	urinary bladder development	IEA	biological process
GO:0060197	cloacal septation	IEA	biological process
GO:0060513	prostatic bud formation	IEA	biological process
GO:0060529	squamous basal epithelial stem cell differentiation involved in prostate gland acinus development	IEA	biological process
GO:0061436	establishment of skin barrier	IEA	biological process
GO:0061436	establishment of skin barrier	ISS	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:1902808	positive regulation of cell cycle G1/S phase transition	IMP	biological process
GO:2000271	positive regulation of fibroblast apoptotic process	IDA	biological process
GO:2000381	negative regulation of mesoderm development	IEA	biological process
GO:2000773	negative regulation of cellular senescence	IMP	biological process
GO:2001235	positive regulation of apoptotic signaling pathway	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IBA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0002039	p53 binding	IBA	molecular function
GO:0003677	DNA binding	NAS	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0003684	damaged DNA binding	IBA	molecular function
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor complex	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IBA	biological process
GO:0010165	response to X-ray	IBA	biological process
GO:0010332	response to gamma radiation	IBA	biological process
GO:0010482	regulation of epidermal cell division	ISS	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0031571	mitotic G1 DNA damage checkpoint	IBA	biological process
GO:0034644	cellular response to UV	IBA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0043523	regulation of neuron apoptotic process	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0045747	positive regulation of Notch signaling pathway	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0050699	WW domain binding	IPI	molecular function
GO:0051289	protein homotetramerization	IPI	biological process
GO:0061436	establishment of skin barrier	ISS	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:1902808	positive regulation of cell cycle G1/S phase transition	IMP	biological process
GO:2000271	positive regulation of fibroblast apoptotic process	IDA	biological process
GO:2000773	negative regulation of cellular senescence	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis	MIK: 20670103
Asthenozoospermia	MIK: 26626315
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 29362488
Male infertility	MIK: 29362488

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26626315	Asthenozoospermia				Male infertility	miR-101-3p miR-151a-5p let-7b-5p
20670103	Associated with spermatogenesis				Male infertility
29362488	Required for apoptosis of male germ cells and regulation of spermatogenesis, Male infertility				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq