• Gene id: 8621

Gene Summary

• Gene Symbol: CDK13   Gene   UCSC   Ensembl
• Aliases: CDC2L, CDC2L5, CHDFIDD, CHED, hCDK13
• Gene name: cyclin dependent kinase 13
• Alternate names: cyclin-dependent kinase 13, CDC2-related protein kinase 5, cell division cycle 2-like protein kinase 5, cell division protein kinase 13, cholinesterase-related cell division controller,
• Gene location: 7p14.1 (39949663: 40099579)     Exons: 1     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a member of the cyclin-dependent serine/threonine protein kinase family. Members of this family are well known for their essential roles as master switches in cell cycle control. The exact function of this protein has n
• OMIM: 603309

Protein Summary

• Protein general information: Q14004  
  • Name: Cyclin dependent kinase 13 (EC 2.7.11.22) (EC 2.7.11.23) (CDC2 related protein kinase 5) (Cell division cycle 2 like protein kinase 5) (Cell division protein kinase 13) (hCDK13) (Cholinesterase related cell division controller)
  • Length: 1512  
  • Mass: 164923
  • Tissue specificity: Expressed in fetal brain, liver, muscle and in adult brain. Also expressed in neuroblastoma and glioblastoma tumors.
• Sequence:

  MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLFLAAPGTAAAAAAAAA
  ASSSCFSPGPPLEVKRLARGKRRAGGRQKRRRGPRAGQEAEKRRVFSLPQPQQDGGGGASSGGGVTPLVEYEDVS
  SQSEQGLLLGGASAATAATAAGGTGGSGGSPASSSGTQRRGEGSERRPRRDRRSSSGRSKERHREHRRRDGQRGG
  SEASKSRSRHSHSGEERAEVAKSGSSSSSGGRRKSASATSSSSSSRKDRDSKAHRSRTKSSKEPPSAYKEPPKAY
  REDKTEPKAYRRRRSLSPLGGRDDSPVSHRASQSLRSRKSPSPAGGGSSPYSRRLPRSPSPYSRRRSPSYSRHSS
  YERGGDVSPSPYSSSSWRRSRSPYSPVLRRSGKSRSRSPYSSRHSRSRSRHRLSRSRSRHSSISPSTLTLKSSLA
  AELNKNKKARAAEAARAAEAAKAAEATKAAEAAAKAAKASNTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPS
  PSSGGTLKNDKAKTKPPLQVTKVENNLIVDKATKKAVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHV
  ALVTSTLPPLPLPPMLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLH
  SKRRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAI
  REIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGL
  DYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSC
  GCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLF
  DYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSLG
  LDDSRTNTPQGVLPSSQLKSQGSSNVAPVKTGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSETQQQ
  LNKINLPAGILATGEKQTDPSTPQQESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKD
  VLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPEPPEPPPVTEEDL
  DYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGIDYQAGDTYVSTSDYKDNFGSSSFSSAPYV
  SNDGLGSSSAPPLERRSFIGNSDIQSLDNYSTASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGPMLFSGDKDH
  RFEYSHGPIAVLANSSDPSTGPESTHPLPAKMHNYNYGGNLQENPSGPSLMHGQTWTSPAQGPGYSQGYRGHIST
  STGRGRGRGLPY

• Structural information:
  • Protein Domains: (705..99-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 5EFQ
  • PDBsum: 5EFQ
  • STRING: ENSP00000181839
• Other Databases: GeneCards:  CDK13  Malacards:  CDK13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0008353	RNA polymerase II CTD heptapeptide repeat kinase activity	IBA	molecular function
GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter	IBA	biological process
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005694	chromosome	IBA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	IBA	biological process
GO:0006468	protein phosphorylation	IBA	biological process
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0030332	cyclin binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0070816	phosphorylation of RNA polymerase II C-terminal domain	IBA	biological process
GO:0008353	RNA polymerase II CTD heptapeptide repeat kinase activity	IDA	molecular function
GO:0070816	phosphorylation of RNA polymerase II C-terminal domain	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0030097	hemopoiesis	IMP	biological process
GO:0019908	nuclear cyclin-dependent protein kinase holoenzyme complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000380	alternative mRNA splicing, via spliceosome	TAS	biological process
GO:0000380	alternative mRNA splicing, via spliceosome	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0007088	regulation of mitotic nuclear division	TAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0008353	RNA polymerase II CTD heptapeptide repeat kinase activity	IEA	molecular function
GO:0002945	cyclin K-CDK13 complex	IPI	cellular component
GO:0030332	cyclin binding	IPI	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:2000737	negative regulation of stem cell differentiation	IEA	biological process
GO:0030332	cyclin binding	IEA	molecular function
GO:0019908	nuclear cyclin-dependent protein kinase holoenzyme complex	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0000380	alternative mRNA splicing, via spliceosome	IEA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21412036

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)