• Gene id: 8620

Gene Summary

• Gene Symbol: NPFF   Gene   UCSC   Ensembl
• Aliases: FMRFAL
• Gene name: neuropeptide FF-amide peptide precursor
• Alternate names: pro-FMRFamide-related neuropeptide FF,
• Gene location: 12q13.13 (53507483: 53506687)     Exons: 3     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and b
• OMIM: 604643

Protein Summary

• Protein general information: O15130  
  • Name: Pro FMRFamide related neuropeptide FF (FMRFamide related peptides) [Cleaved into: Neuropeptide SF (NPSF); Neuropeptide FF (NPFF); Neuropeptide AF (NPAF)]
  • Length: 113  
  • Mass: 12440
• Sequence:

  MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQR
  FGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK

• Structural information:
  • Interpro: IPR008065  
  • STRING: ENSP00000267017
• Other Databases: GeneCards:  NPFF  Malacards:  NPFF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0043204	perikaryon	IBA	cellular component
GO:0043679	axon terminus	IBA	cellular component
GO:0060079	excitatory postsynaptic potential	IBA	biological process
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007218	neuropeptide signaling pathway	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0003254	regulation of membrane depolarization	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0010459	negative regulation of heart rate	IEA	biological process
GO:0031982	vesicle	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0001664	G protein-coupled receptor binding	IEA	molecular function
GO:0002438	acute inflammatory response to antigenic stimulus	IEA	biological process
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0021510	spinal cord development	IEA	biological process
GO:0030103	vasopressin secretion	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0032099	negative regulation of appetite	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0046676	negative regulation of insulin secretion	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0070253	somatostatin secretion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)