• Gene id: 8615

Gene Summary

• Gene Symbol: USO1   Gene   UCSC   Ensembl
• Aliases: P115, TAP, VDP
• Gene name: USO1 vesicle transport factor
• Alternate names: general vesicular transport factor p115, USO1 vesicle docking protein homolog, transcytosis associated protein, vesicle docking protein p115,
• Gene location: 4q21.1 (75724521: 75814288)     Exons: 26     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates
• OMIM: 603344

Protein Summary

• Protein general information: O60763  
  • Name: General vesicular transport factor p115 (Protein USO1 homolog) (Transcytosis associated protein) (TAP) (Vesicle docking protein)
  • Length: 962  
  • Mass: 107895
• Sequence:

  MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQAMEHLIHVLQTDRSD
  SEIIGYALDTLYNIISNEEEEEVEENSTRQSEDLGSQFTEIFIKQQENVTLLLSLLEEFDFHVRWPGVKLLTSLL
  KQLGPQVQQIILVSPMGVSRLMDLLADSREVIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIISEEGNSDG
  GIVVEDCLILLQNLLKNNNSNQNFFKEGSYIQRMKPWFEVGDENSGWSAQKVTNLHLMLQLVRVLVSPTNPPGAT
  SSCQKAMFQCGLLQQLCTILMATGVPADILTETINTVSEVIRGCQVNQDYFASVNAPSNPPRPAIVVLLMSMVNE
  RQPFVLRCAVLYCFQCFLYKNQKGQGEIVSTLLPSTIDATGNSVSAGQLLCGGLFSTDSLSNWCAAVALAHALQE
  NATQKEQLLRVQLATSIGNPPVSLLQQCTNILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQ
  IAENLGEEEQLVQGLCALLLGISIYFNDNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPN
  FPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDNIVTHYKNMIREQDLQLEELRQQVST
  LKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQ
  SQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAF
  AKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEIT
  DSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR000225  IPR041209  IPR006955   IPR006953  
  • Prosite: PS50176
  • PDB: 2W3C
  • PDBsum: 2W3C
  • STRING: ENSP00000444850
• Other Databases: GeneCards:  USO1  Malacards:  USO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061025	membrane fusion	IBA	biological process
GO:0048211	Golgi vesicle docking	IBA	biological process
GO:0045056	transcytosis	IBA	biological process
GO:0012507	ER to Golgi transport vesicle membrane	IBA	cellular component
GO:0005795	Golgi stack	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	ISS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0048280	vesicle fusion with Golgi apparatus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	biological process
GO:1900076	regulation of cellular response to insulin stimulus	IEA	biological process
GO:0032252	secretory granule localization	IEA	biological process
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0007030	Golgi organization	IEA	biological process
GO:0061025	membrane fusion	IEA	biological process
GO:0045056	transcytosis	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)