• Gene id: 8613

Gene Summary

• Gene Symbol: PLPP3   Gene   UCSC   Ensembl
• Aliases: Dri42, LPP3, PAP2B, PPAP2B, VCIP
• Gene name: phospholipid phosphatase 3
• Alternate names: phospholipid phosphatase 3, PAP2 beta, lipid phosphate phosphohydrolase 3, phosphatidate phosphohydrolase type 2b, phosphatidic acid phosphatase type 2B, type-2 phosphatidic acid phosphatase-beta, vascular endothelial growth factor and type I collagen inducible,
• Gene location: 1p32.2 (56579562: 56494760)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction media
• OMIM: 606553

Protein Summary

• Protein general information: O14495  
  • Name: Phospholipid phosphatase 3 (EC 3.1.3. ) (EC 3.1.3.4) (Lipid phosphate phosphohydrolase 3) (PAP2 beta) (Phosphatidate phosphohydrolase type 2b) (Phosphatidic acid phosphatase 2b) (PAP 2b) (PAP2b) (Vascular endothelial growth factor and type I collagen indu
  • Length: 311  
  • Mass: 35116
  • Tissue specificity: Ubiquitously expressed (PubMed
• Sequence:

  MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKY
  PLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVS
  IGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARL
  LRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD
  IIDRNNHHNMM

• Structural information:
  • Interpro: IPR028675  IPR036938  IPR000326  
  • STRING: ENSP00000360296
• Other Databases: GeneCards:  PLPP3  Malacards:  PLPP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016791	phosphatase activity	IBA	molecular function
GO:0042392	sphingosine-1-phosphate phosphatase activity	IBA	molecular function
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0008195	phosphatidate phosphatase activity	IBA	molecular function
GO:0042577	lipid phosphatase activity	IBA	molecular function
GO:0033631	cell-cell adhesion mediated by integrin	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0008195	phosphatidate phosphatase activity	IDA	molecular function
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0008195	phosphatidate phosphatase activity	IDA	molecular function
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0106235	ceramide-1-phosphate phosphatase activity	IDA	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IDA	cellular component
GO:0070971	endoplasmic reticulum exit site	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0042392	sphingosine-1-phosphate phosphatase activity	IDA	molecular function
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0006670	sphingosine metabolic process	IDA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IDA	molecular function
GO:0006670	sphingosine metabolic process	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	biological process
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0042577	lipid phosphatase activity	IEA	molecular function
GO:0030111	regulation of Wnt signaling pathway	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001933	negative regulation of protein phosphorylation	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0034109	homotypic cell-cell adhesion	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0005912	adherens junction	TAS	cellular component
GO:0044329	canonical Wnt signaling pathway involved in positive regulation of cell-cell adhesion	IMP	biological process
GO:0044330	canonical Wnt signaling pathway involved in positive regulation of wound healing	IMP	biological process
GO:0044328	canonical Wnt signaling pathway involved in positive regulation of endothelial cell migration	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa00564	Glycerophospholipid metabolism
hsa05231	Choline metabolism in cancer
hsa04666	Fc gamma R-mediated phagocytosis
hsa00561	Glycerolipid metabolism
hsa00600	Sphingolipid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R