• Gene id: 8611

Gene Summary

• Gene Symbol: PLPP1   Gene   UCSC   Ensembl
• Aliases: LLP1a, LPP1, PAP-2a, PAP2, PPAP2A
• Gene name: phospholipid phosphatase 1
• Alternate names: phospholipid phosphatase 1, lipid phosphate phosphohydrolase 1a, phosphatidate phosphohydrolase type 2a, phosphatidic acid phosphatase 2a, phosphatidic acid phosphatase type 2A, phosphatidic acid phosphohydrolase type 2a, type-2 phosphatidic acid phosphatase al,
• Gene location: 5q11.2 (55535077: 55424841)     Exons: 7     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme i
• OMIM: 607124

Protein Summary

• Protein general information: O14494  
  • Name: Phospholipid phosphatase 1 (EC 3.1.3. ) (EC 3.1.3.106) (EC 3.1.3.4) (EC 3.1.3.81) (Lipid phosphate phosphohydrolase 1) (PAP2 alpha) (Phosphatidate phosphohydrolase type 2a) (Phosphatidic acid phosphatase 2a) (PAP 2a) (PAP2a)
  • Length: 284  
  • Mass: 32156
  • Tissue specificity: Widely expressed with highest expression found in prostate (PubMed
• Sequence:

  MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGE
  TLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEY
  YICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHW
  SDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

• Structural information:
  • Interpro: IPR028670  IPR036938  IPR000326  
• Other Databases: GeneCards:  PLPP1  Malacards:  PLPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042577	lipid phosphatase activity	IBA	molecular function
GO:0008195	phosphatidate phosphatase activity	IBA	molecular function
GO:0007165	signal transduction	IBA	biological process
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0016791	phosphatase activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0042577	lipid phosphatase activity	IDA	molecular function
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0008195	phosphatidate phosphatase activity	IDA	molecular function
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0008195	phosphatidate phosphatase activity	IDA	molecular function
GO:0106235	ceramide-1-phosphate phosphatase activity	IDA	molecular function
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0006670	sphingosine metabolic process	IDA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IDA	molecular function
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0005901	caveola	ISS	cellular component
GO:0007165	signal transduction	IMP	biological process
GO:0000810	diacylglycerol diphosphate phosphatase activity	ISS	molecular function
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0000810	diacylglycerol diphosphate phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005901	caveola	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0042577	lipid phosphatase activity	IEA	molecular function
GO:0000810	diacylglycerol diphosphate phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006670	sphingosine metabolic process	IEA	biological process
GO:0006672	ceramide metabolic process	IEA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IEA	molecular function
GO:0046839	phospholipid dephosphorylation	IEA	biological process
GO:0106235	ceramide-1-phosphate phosphatase activity	IEA	molecular function
GO:0005901	caveola	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0008195	phosphatidate phosphatase activity	IDA	molecular function
GO:0042577	lipid phosphatase activity	IDA	molecular function
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0046839	phospholipid dephosphorylation	TAS	biological process
GO:0030521	androgen receptor signaling pathway	NAS	biological process
GO:0019216	regulation of lipid metabolic process	NAS	biological process
GO:0008285	negative regulation of cell population proliferation	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030518	intracellular steroid hormone receptor signaling pathway	TAS	biological process
GO:0008195	phosphatidate phosphatase activity	NAS	molecular function
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa00564	Glycerophospholipid metabolism
hsa05231	Choline metabolism in cancer
hsa04666	Fc gamma R-mediated phagocytosis
hsa00561	Glycerolipid metabolism
hsa00600	Sphingolipid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)