• Gene id: 8605

Gene Summary

• Gene Symbol: PLA2G4C   Gene   UCSC   Ensembl
• Aliases: CPLA2-gamma
• Gene name: phospholipase A2 group IVC
• Alternate names: cytosolic phospholipase A2 gamma, phospholipase A2, group IVC (cytosolic, calcium-independent),
• Gene location: 19q13.33 (48111382: 48047842)     Exons: 21     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein which is a member of the phospholipase A2 enzyme family which hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids, both of which serve as precursors in the production of signaling molecules. The en
• OMIM: 603602

Protein Summary

• Protein general information: Q9UP65  
  • Name: Cytosolic phospholipase A2 gamma (cPLA2 gamma) (EC 3.1.1.4) (Phospholipase A2 group IVC)
  • Length: 541  
  • Mass: 60939
  • Tissue specificity: Highly expressed in heart and skeletal muscle. {ECO
• Sequence:

  MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACLGVLSEMKEQGLLDAV
  TYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSLQKTIQAARSENYSLTDFWAYMVISKQTREL
  PESHLSNMKKPVEEGTLPYPIFAAIDNDLQPSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVR
  THPERDLTFLRGLWGSALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQESSQGEHPPPED
  EGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGICASKWEWGTTHNFLYKHGGIRDKIM
  SSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFETIRATTDYCRRHKIPFPQVEEAELDLWSKAP
  ASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNV
  AGLYYPKDSARSCCLA

• Structural information:
  • Protein Domains: (1..54-)
    (/note="PLA2c-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00555"-)
  • Interpro: IPR016035  IPR002642  
  • Prosite: PS51210
  • STRING: ENSP00000472546
• Other Databases: GeneCards:  PLA2G4C  Malacards:  PLA2G4C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0047498	calcium-dependent phospholipase A2 activity	IBA	molecular function
GO:0046475	glycerophospholipid catabolic process	IBA	biological process
GO:0005635	nuclear envelope	IBA	cellular component
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0005811	lipid droplet	IDA	cellular component
GO:0008374	O-acyltransferase activity	IDA	molecular function
GO:0004622	lysophospholipase activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0036151	phosphatidylcholine acyl-chain remodeling	IDA	biological process
GO:0008374	O-acyltransferase activity	IDA	molecular function
GO:0004622	lysophospholipase activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	IDA	biological process
GO:0006663	platelet activating factor biosynthetic process	IDA	biological process
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0140042	lipid droplet formation	IMP	biological process
GO:0004620	phospholipase activity	IEA	molecular function
GO:0009395	phospholipid catabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0004622	lysophospholipase activity	TAS	molecular function
GO:0004622	lysophospholipase activity	TAS	molecular function
GO:0004622	lysophospholipase activity	TAS	molecular function
GO:0004622	lysophospholipase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0008970	phospholipase A1 activity	TAS	molecular function
GO:0008970	phospholipase A1 activity	TAS	molecular function
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0047499	calcium-independent phospholipase A2 activity	IDA	molecular function
GO:0046475	glycerophospholipid catabolic process	IDA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0019369	arachidonic acid metabolic process	NAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0007567	parturition	NAS	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0005543	phospholipid binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04217	Necroptosis
hsa04921	Oxytocin signaling pathway
hsa04724	Glutamatergic synapse
hsa04270	Vascular smooth muscle contraction
hsa04611	Platelet activation
hsa00564	Glycerophospholipid metabolism
hsa04726	Serotonergic synapse
hsa05231	Choline metabolism in cancer
hsa04666	Fc gamma R-mediated phagocytosis
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04912	GnRH signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa00590	Arachidonic acid metabolism
hsa04730	Long-term depression
hsa04370	VEGF signaling pathway
hsa00565	Ether lipid metabolism
hsa04913	Ovarian steroidogenesis
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R