• Gene id: 85865

Gene Summary

• Gene Symbol: GTPBP10   Gene   UCSC   Ensembl
• Aliases: ObgH2, UG0751c10
• Gene name: GTP binding protein 10
• Alternate names: GTP-binding protein 10, GTP binding protein 10 (putative), protein obg homolog 2,
• Gene location: 7q21.13 (90346715: 90391452)     Exons: 10     NC_000007.14
• Gene summary(Entrez): Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubM
• OMIM: 602996

Protein Summary

• Protein general information: A4D1E9  
  • Name: GTP binding protein 10 (Protein obg homolog 2) (ObgH2)
  • Length: 387  
  • Mass: 42933
• Sequence:

  MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANS
  KISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIAD
  VGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIE
  RTRQLLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPK
  DFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTMSSTEPPS
  KHAVTTSKMDII

• Structural information:
  • Protein Domains: (13..14-)
    (/note="Obg-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01231-)
    (149..34-)
    (/note="OBG-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01047"-)
  • Interpro: IPR031167  IPR035101  IPR006169  IPR036726  IPR006073   IPR027417  
  • Prosite: PS51710 PS51883
  • CDD: cd01898
  • STRING: ENSP00000222511
• Other Databases: GeneCards:  GTPBP10  Malacards:  GTPBP10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R