• Gene id: 8581

Gene Summary

• Gene Symbol: LY6D   Gene   UCSC   Ensembl
• Aliases: E48, Ly-6D
• Gene name: lymphocyte antigen 6 family member D
• Alternate names: lymphocyte antigen 6D, e48 antigen, lymphocyte antigen 6 complex, locus D,
• Gene location: 8q24.3 (142786538: 142784881)     Exons: 3     NC_000008.11
• OMIM: 603640

Protein Summary

• Protein general information: Q14210  
  • Name: Lymphocyte antigen 6D (Ly 6D) (E48 antigen)
  • Length: 128  
  • Mass: 13286
  • Tissue specificity: Expressed exclusively at the outer cell surface of transitional epithelia and the keratinocyte of stratified squamous epithelia.
• Sequence:

  MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQG
  QVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL

• Structural information:
  • Protein Domains: (21..10-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR018363  IPR016054  IPR042339  
  • Prosite: PS00983
  • STRING: ENSP00000301263
• Other Databases: GeneCards:  LY6D  Malacards:  LY6D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030098	lymphocyte differentiation	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0030098	lymphocyte differentiation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030098	lymphocyte differentiation	IEA	biological process
GO:0035634	response to stilbenoid	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881