• Gene id: 8578

Gene Summary

• Gene Symbol: SCARF1   Gene   UCSC   Ensembl
• Aliases: SREC, SREC-I, SREC1
• Gene name: scavenger receptor class F member 1
• Alternate names: scavenger receptor class F member 1, acetyl LDL receptor, scavenger receptor expressed by endothelial cells 1,
• Gene location: 17p13.3 (1645731: 1633857)     Exons: 11     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a scavenger receptor that is expressed in endothelial cells. It regulates the uptake of chemically modified low density lipoproteins, including acetylated low density lipoprotein (Ac-LDL), and it may be involved in athe
• OMIM: 603508

Protein Summary

• Protein general information: Q14162  
  • Name: Scavenger receptor class F member 1 (Acetyl LDL receptor) (Scavenger receptor expressed by endothelial cells 1) (SREC I)
  • Length: 830  
  • Mass: 87387
  • Tissue specificity: Endothelial cells.
• Sequence:

  MGLGLLLPLLLLWTRGTQGSELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLC
  RCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHC
  EPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCEC
  VRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPG
  TFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDTVTGDCVCSAG
  YWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDTALIAGSLVPLLLLFLGLACCACCCWAPRS
  DLKDRPARDGATVSRMKLQVWGTLTSLGSTLPCRSLSSHKLPWVTVSHHDPEVPFNHSFIEPPSAGWATDDSFSS
  DPESGEADEVPAYCVPPQEGMVPVAQAGSSEASLAAGAFPPPEDASTPFAIPRTSSLARAKRPSVSFAEGTKFAP
  QSRRSSGELSSPLRKPKRLSRGAQSGPEGREAEESTGPEEAEAPESFPAAASPGDSATGHRRPPLGGRTVAEHVE
  AIEGSVQESSGPVTTIYMLAGKPRGSEGPVRSVFRHFGSFQKGQAEAKVKRAIPKPPRQALNRKKGSPGLASGSV
  GQSPNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPIS
  RPPEP

• Structural information:
  • Protein Domains: (53..8-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (95..13-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (155..19-)
    (/note="EGF-like-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PR-)
  • Interpro: IPR013032  IPR000742  IPR009030  IPR002049  IPR033329   IPR042635  
  • Prosite: PS00022 PS01186 PS50026
  • STRING: ENSP00000263071
• Other Databases: GeneCards:  SCARF1  Malacards:  SCARF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010976	positive regulation of neuron projection development	IBA	biological process
GO:0030169	low-density lipoprotein particle binding	IBA	molecular function
GO:0048680	positive regulation of axon regeneration	ISS	biological process
GO:0016322	neuron remodeling	ISS	biological process
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048680	positive regulation of axon regeneration	IEA	biological process
GO:0016358	dendrite development	IEA	biological process
GO:0016322	neuron remodeling	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006707	cholesterol catabolic process	IC	biological process
GO:0005044	scavenger receptor activity	IDA	molecular function
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq