• Gene id: 8575

Gene Summary

• Gene Symbol: PRKRA   Gene   UCSC   Ensembl
• Aliases: DYT16, HSD14, PACT, RAX
• Gene name: protein activator of interferon induced protein kinase EIF2AK2
• Alternate names: interferon-inducible double-stranded RNA-dependent protein kinase activator A, PKR-associated protein X, PKR-associating protein X, protein activator of the interferon-induced protein kinase, protein kinase, interferon-inducible double-stranded RNA-dependent ,
• Gene location: 2q31.2 (178451174: 178431413)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript var
• OMIM: 603424

Protein Summary

• Protein general information: O75569  
  • Name: Interferon inducible double stranded RNA dependent protein kinase activator A (PKR associated protein X) (PKR associating protein X) (Protein activator of the interferon induced protein kinase) (Protein kinase, interferon inducible double stranded RNA dep
  • Length: 313  
  • Mass: 34404
• Sequence:

  MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDI
  TCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQE
  GGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHSLGCTWHSLRNSPGEK
  INLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAH
  NALQYLKIIAERK

• Structural information:
  • Protein Domains: (34..10-)
    (/note="DRBM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (126..19-)
    (/note="DRBM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (240..30-)
    (/note="DRBM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266"-)
  • Interpro: IPR014720  IPR033363  IPR032478  
  • Prosite: PS50137
  • CDD: cd00048
  • PDB: 2DIX
  • PDBsum: 2DIX
  • DIP: 41809
  • STRING: ENSP00000318176
• Other Databases: GeneCards:  PRKRA  Malacards:  PRKRA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030422	production of siRNA involved in RNA interference	IEA	biological process
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0008047	enzyme activator activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0009615	response to virus	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010586	miRNA metabolic process	TAS	biological process
GO:0030422	production of siRNA involved in RNA interference	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IEA	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0043583	ear development	IEA	biological process
GO:0042474	middle ear morphogenesis	IEA	biological process
GO:0042473	outer ear morphogenesis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0070883	pre-miRNA binding	IDA	molecular function
GO:0031054	pre-miRNA processing	IDA	biological process
GO:0070578	RISC-loading complex	IDA	cellular component
GO:0050821	protein stabilization	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0030422	production of siRNA involved in RNA interference	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Primary dystonia	KEGG:H00831
Primary dystonia	KEGG:H00831
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)