• Gene id: 8570

Gene Summary

• Gene Symbol: KHSRP   Gene   UCSC   Ensembl
• Aliases: FBP2, FUBP2, KSRP, p75
• Gene name: KH-type splicing regulatory protein
• Alternate names: far upstream element-binding protein 2, FUSE-binding protein 2, epididymis secretory sperm binding protein,
• Gene location: 19p13.3 (6424810: 6413101)     Exons: 20     NC_000019.10
• Gene summary(Entrez): The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175
• OMIM: 607873

Protein Summary

• Protein general information: Q92945  
  • Name: Far upstream element binding protein 2 (FUSE binding protein 2) (KH type splicing regulatory protein) (KSRP) (p75)
  • Length: 711  
  • Mass: 73115
  • Tissue specificity: Detected in neural and non-neural cell lines.
• Sequence:

  MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFA
  DAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYR
  VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHD
  NANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVM
  DILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGP
  PDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAI
  NQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQ
  GPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAA
  PPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYS
  AAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ

• Structural information:
  • Protein Domains: (144..20-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (233..29-)
    (/note="KH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (322..38-)
    (/note="KH-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (-)
  • Interpro: IPR015096  IPR004087  IPR004088  IPR036612  
  • Prosite: PS50084
  • PDB: 2HH2 2HH3 2JVZ 2OPU 2OPV 4B8T
  • PDBsum: 2HH2 2HH3 2JVZ 2OPU 2OPV 4B8T
  • DIP: 48484
  • STRING: ENSP00000381216
• Other Databases: GeneCards:  KHSRP  Malacards:  KHSRP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0045019	negative regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0061014	positive regulation of mRNA catabolic process	IDA	biological process
GO:0010586	miRNA metabolic process	IMP	biological process
GO:0000178	exosome (RNase complex)	NAS	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0071345	cellular response to cytokine stimulus	IMP	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0003729	mRNA binding	IEA	molecular function
GO:2000628	regulation of miRNA metabolic process	IEA	biological process
GO:0006402	mRNA catabolic process	IEA	biological process
GO:0010989	negative regulation of low-density lipoprotein particle clearance	IGI	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0008380	RNA splicing	TAS	biological process
GO:0000375	RNA splicing, via transesterification reactions	TAS	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq