• Gene id: 857

Gene Summary

• Gene Symbol: CAV1   Gene   UCSC   Ensembl
• Aliases: BSCL3, CGL3, LCCNS, MSTP085, PPH3, VIP21
• Gene name: caveolin 1
• Alternate names: caveolin-1, caveolin 1, caveolae protein, 22kDa, cell growth-inhibiting protein 32,
• Gene location: 7q31.2 (116525008: 116561184)     Exons: 4     NC_000007.14
• Gene summary(Entrez): The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway a
• OMIM: 601047

Protein Summary

• Protein general information: Q03135  
  • Name: Caveolin 1
  • Length: 178  
  • Mass: 20472
  • Tissue specificity: Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Expressed in the brain. {ECO
• Sequence:

  MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEP
  EGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI
  YVHTVCDPLFEAVGKIFSNVRINLQKEI

• Structural information:
  • Interpro: IPR015504  IPR001612  IPR018361  
  • Prosite: PS01210
  • DIP: 5960
  • STRING: ENSP00000339191
• Other Databases: GeneCards:  CAV1  Malacards:  CAV1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010875	positive regulation of cholesterol efflux	IDA	biological process
GO:0051117	ATPase binding	ISS	molecular function
GO:0045121	membrane raft	ISS	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:1903071	positive regulation of ER-associated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051117	ATPase binding	IPI	molecular function
GO:0032092	positive regulation of protein binding	IMP	biological process
GO:0031398	positive regulation of protein ubiquitination	IMP	biological process
GO:0000139	Golgi membrane	IDA	cellular component
GO:0042632	cholesterol homeostasis	TAS	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030301	cholesterol transport	TAS	biological process
GO:0015485	cholesterol binding	TAS	molecular function
GO:0019065	receptor-mediated endocytosis of virus by host cell	IGI	biological process
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IBA	cellular component
GO:0044325	ion channel binding	IBA	molecular function
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0030154	cell differentiation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0001937	negative regulation of endothelial cell proliferation	IBA	biological process
GO:0070836	caveola assembly	IBA	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	IBA	biological process
GO:0060090	molecular adaptor activity	IBA	molecular function
GO:0042383	sarcolemma	IBA	colocalizes with
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005925	focal adhesion	IBA	colocalizes with
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0031295	T cell costimulation	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005901	caveola	IEA	cellular component
GO:0070836	caveola assembly	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043627	response to estrogen	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032570	response to progesterone	IDA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048365	Rac GTPase binding	IPI	molecular function
GO:1900027	regulation of ruffle assembly	IDA	biological process
GO:2000535	regulation of entry of bacterium into host cell	IDA	biological process
GO:0009617	response to bacterium	IDA	biological process
GO:0005901	caveola	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050999	regulation of nitric-oxide synthase activity	TAS	biological process
GO:0050999	regulation of nitric-oxide synthase activity	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005811	lipid droplet	TAS	cellular component
GO:0005811	lipid droplet	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001937	negative regulation of endothelial cell proliferation	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0006940	regulation of smooth muscle contraction	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0016504	peptidase activator activity	IEA	molecular function
GO:0019217	regulation of fatty acid metabolic process	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0033484	nitric oxide homeostasis	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0045019	negative regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051001	negative regulation of nitric-oxide synthase activity	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:0052547	regulation of peptidase activity	IEA	biological process
GO:0055074	calcium ion homeostasis	IEA	biological process
GO:0060056	mammary gland involution	IEA	biological process
GO:0060546	negative regulation of necroptotic process	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0098911	regulation of ventricular cardiac muscle cell action potential	IEA	biological process
GO:1901844	regulation of cell communication by electrical coupling involved in cardiac conduction	IEA	biological process
GO:1903598	positive regulation of gap junction assembly	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	IEA	biological process
GO:0002026	regulation of the force of heart contraction	IEA	biological process
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0002095	caveolar macromolecular signaling complex	IEA	cellular component
GO:0003057	regulation of the force of heart contraction by chemical signal	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0010608	posttranscriptional regulation of gene expression	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019915	lipid storage	IEA	biological process
GO:0030674	protein-macromolecule adaptor activity	IEA	molecular function
GO:0030857	negative regulation of epithelial cell differentiation	IEA	biological process
GO:0030879	mammary gland development	IEA	biological process
GO:0038016	insulin receptor internalization	IEA	biological process
GO:0042310	vasoconstriction	IEA	biological process
GO:0042532	negative regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0043409	negative regulation of MAPK cascade	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0050998	nitric-oxide synthase binding	IEA	molecular function
GO:0051899	membrane depolarization	IEA	biological process
GO:0060090	molecular adaptor activity	IEA	molecular function
GO:0061099	negative regulation of protein tyrosine kinase activity	IEA	biological process
GO:0070836	caveola assembly	IEA	biological process
GO:0071375	cellular response to peptide hormone stimulus	IEA	biological process
GO:0071711	basement membrane organization	IEA	biological process
GO:0086091	regulation of heart rate by cardiac conduction	IEA	biological process
GO:0086098	angiotensin-activated signaling pathway involved in heart process	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:1900085	negative regulation of peptidyl-tyrosine autophosphorylation	IEA	biological process
GO:2000811	negative regulation of anoikis	IEA	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0050998	nitric-oxide synthase binding	IPI	molecular function
GO:0051480	regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0051592	response to calcium ion	ISS	biological process
GO:0052547	regulation of peptidase activity	ISS	biological process
GO:0055074	calcium ion homeostasis	ISS	biological process
GO:0060056	mammary gland involution	ISS	biological process
GO:2000286	receptor internalization involved in canonical Wnt signaling pathway	IMP	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0051899	membrane depolarization	ISS	biological process
GO:0070836	caveola assembly	IMP	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0070320	inward rectifier potassium channel inhibitor activity	IDA	molecular function
GO:0005113	patched binding	NAS	molecular function
GO:0016504	peptidase activator activity	ISS	molecular function
GO:0044325	ion channel binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060090	molecular adaptor activity	TAS	molecular function
GO:1900085	negative regulation of peptidyl-tyrosine autophosphorylation	IMP	biological process
GO:0070836	caveola assembly	IGI	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	IMP	biological process
GO:0005901	caveola	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0098909	regulation of cardiac muscle cell action potential involved in regulation of contraction	IC	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0001570	vasculogenesis	ISS	biological process
GO:0001666	response to hypoxia	ISS	biological process
GO:0001937	negative regulation of endothelial cell proliferation	ISS	biological process
GO:0006816	calcium ion transport	ISS	biological process
GO:0006874	cellular calcium ion homeostasis	ISS	biological process
GO:0006940	regulation of smooth muscle contraction	ISS	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	ISS	biological process
GO:0019217	regulation of fatty acid metabolic process	ISS	biological process
GO:0016050	vesicle organization	ISS	biological process
GO:0044860	protein localization to plasma membrane raft	ISS	biological process
GO:0098911	regulation of ventricular cardiac muscle cell action potential	ISS	biological process
GO:1901844	regulation of cell communication by electrical coupling involved in cardiac conduction	ISS	biological process
GO:1903598	positive regulation of gap junction assembly	ISS	biological process
GO:0033484	nitric oxide homeostasis	ISS	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0045019	negative regulation of nitric oxide biosynthetic process	ISS	biological process
GO:0005925	focal adhesion	IDA	colocalizes with
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0000188	inactivation of MAPK activity	ISS	biological process
GO:0098903	regulation of membrane repolarization during action potential	IMP	biological process
GO:1903609	negative regulation of inward rectifier potassium channel activity	IMP	biological process
GO:1901380	negative regulation of potassium ion transmembrane transport	IMP	biological process
GO:0070836	caveola assembly	ISS	biological process
GO:1903361	protein localization to basolateral plasma membrane	ISS	biological process
GO:0070836	caveola assembly	ISS	biological process
GO:0071375	cellular response to peptide hormone stimulus	ISS	biological process
GO:0086091	regulation of heart rate by cardiac conduction	ISS	biological process
GO:0086098	angiotensin-activated signaling pathway involved in heart process	ISS	biological process
GO:0006641	triglyceride metabolic process	ISS	biological process
GO:0007519	skeletal muscle tissue development	ISS	biological process
GO:0008104	protein localization	ISS	biological process
GO:0019915	lipid storage	ISS	biological process
GO:0030193	regulation of blood coagulation	IMP	biological process
GO:0030857	negative regulation of epithelial cell differentiation	ISS	biological process
GO:0030879	mammary gland development	ISS	biological process
GO:0032507	maintenance of protein location in cell	ISS	biological process
GO:0043409	negative regulation of MAPK cascade	ISS	biological process
GO:0045907	positive regulation of vasoconstriction	ISS	biological process
GO:0005901	caveola	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0010952	positive regulation of peptidase activity	IEA	biological process
GO:0010952	positive regulation of peptidase activity	IEA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0072584	caveolin-mediated endocytosis	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:2000811	negative regulation of anoikis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048550	negative regulation of pinocytosis	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:0031397	negative regulation of protein ubiquitination	IMP	biological process
GO:0071455	cellular response to hyperoxia	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0060355	positive regulation of cell adhesion molecule production	IMP	biological process
GO:0034141	positive regulation of toll-like receptor 3 signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04510	Focal adhesion
hsa05205	Proteoglycans in cancer
hsa05418	Fluid shear stress and atherosclerosis
hsa05100	Bacterial invasion of epithelial cells
hsa05416	Viral myocarditis
hsa04144	Endocytosis
hsa04510	Focal adhesion
hsa05205	Proteoglycans in cancer
hsa05418	Fluid shear stress and atherosclerosis
hsa05416	Viral myocarditis
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Cancer	GAD: 16820915
Congenital generalized lipodystrophy	KEGG: H00419
Polycystic ovary syndrome (PCOS)	INFBASE: 23225242
Female infertility	INFBASE: 22904171
Pulmonary arterial hypertension	KEGG: H01621
Pulmonary arterial hypertension	KEGG:H01621
Congenital generalized lipodystrophy	KEGG:H00419
Pulmonary arterial hypertension	KEGG:H01621
Congenital generalized lipodystrophy	KEGG:H00419
Prostate cancer	PMID:14506154
Prostate cancer	PMID:11170154
Prostate cancer	PMID:15948133
primary open angle glaucoma	PMID:24572674
primary open angle glaucoma	PMID:20835238
urinary bladder cancer	PMID:12866378
acoustic neuroma	PMID:20881564
leiomyoma	PMID:17952758
Limited scleroderma	PMID:22402147
Diffuse scleroderma	PMID:22402147
Breast cancer	PMID:21585620
Breast cancer	PMID:15375584
Breast cancer	PMID:21965771
Melanoma	PMID:22134245
Multiple sclerosis	PMID:19828204
Transitional cell carcinoma	PMID:16328005
Breast carcinoma	PMID:17915016
Breast carcinoma	PMID:11289096
ovarian carcinoma	PMID:11032026
systemic scleroderma	PMID:18759267
systemic scleroderma	PMID:22402147
renal cell carcinoma	PMID:15247769
Pulmonary hypertension	PMID:17470567
Psoriasis	PMID:12366416
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Erectile dysfunction	MIK: 28923309
Male infertility	MIK: 28923309
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28923309	DM-related erectile dysfunction, Male infertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray