• Gene id: 8569

Gene Summary

• Gene Symbol: MKNK1   Gene   UCSC   Ensembl
• Aliases: MNK1
• Gene name: MAPK interacting serine/threonine kinase 1
• Alternate names: MAP kinase-interacting serine/threonine-protein kinase 1, MAP kinase interacting serine/threonine kinase 1, MAP kinase signal-integrating kinase 1, MAPK signal-integrating kinase 1,
• Gene location: 1p33 (46604310: 46557406)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription
• OMIM: 600022

Protein Summary

• Protein general information: Q9BUB5  
  • Name: MAP kinase interacting serine/threonine protein kinase 1 (EC 2.7.11.1) (MAP kinase signal integrating kinase 1) (MAPK signal integrating kinase 1) (Mnk1)
  • Length: 465  
  • Mass: 51342
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEY
  AVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRV
  VRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKV
  SPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP
  FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQ
  GQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRAL
  AQAGRGEDRSPPTAL

• Structural information:
  • Protein Domains: (49..37-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2HW6 2Y9Q 5WVD
  • PDBsum: 2HW6 2Y9Q 5WVD
  • STRING: ENSP00000361014
• Other Databases: GeneCards:  MKNK1  Malacards:  MKNK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0009931	calcium-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04910	Insulin signaling pathway
hsa04066	HIF-1 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881