• Gene id: 8562

Gene Summary

• Gene Symbol: DENR   Gene   UCSC   Ensembl
• Aliases: DRP, DRP1, SMAP-3
• Gene name: density regulated re-initiation and release factor
• Alternate names: density-regulated protein, smooth muscle cell associated protein-3,
• Gene location: 12q24.31 (122752823: 122771063)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains
• OMIM: 604550

Protein Summary

• Protein general information: O43583  
  • Name: Density regulated protein (DRP) (Protein DRP1) (Smooth muscle cell associated protein 3) (SMAP 3)
  • Length: 198  
  • Mass: 22092
  • Tissue specificity: Highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. Weakly expressed in the lung and kidney. {ECO
• Sequence:

  MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPK
  QEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQ
  KFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

• Structural information:
  • Protein Domains: (115..18-)
    (/note="SUI1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00200"-)
  • Interpro: IPR005873  IPR001950  IPR036877  
  • Prosite: PS50296
  • PDB: 5ONS 5VYC 6MS4
  • PDBsum: 5ONS 5VYC 6MS4
  • STRING: ENSP00000280557
• Other Databases: GeneCards:  DENR  Malacards:  DENR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0002188	translation reinitiation	IBA	biological process
GO:0001731	formation of translation preinitiation complex	IBA	biological process
GO:0075522	IRES-dependent viral translational initiation	IDA	biological process
GO:0032790	ribosome disassembly	IDA	biological process
GO:0001731	formation of translation preinitiation complex	IDA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq