Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 8559
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol PRPF18   Gene   UCSC   Ensembl
Aliases PRP18, hPrp18
Gene name pre-mRNA processing factor 18
Alternate names pre-mRNA-splicing factor 18, PRP18 homolog, PRP18 pre-mRNA processing factor 18 homolog, PRP18 pre-mRNA processing factor 18 homolog(PRPF18),
Gene location 10p13 (149505305: 149476987)     Exons: 11     NC_000023.11
Gene summary(Entrez) Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which func
OMIM 604993

Protein Summary
Protein general information Q99633  

Name: Pre mRNA splicing factor 18 (PRP18 homolog) (hPRP18)

Length: 342  Mass: 39860

Sequence MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLTSSNPVLELELAEEKL
PMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLNEIVGGQEPGE
EDTQNDLKVHEENTTIEELEALGESLGKGDDHKDMDIITKFLKFLLGVWAKELNAREDYVKRSVQGKLNSATQKQ
TESYLRPLFRKLRKRNLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWPIGVTMVGIHARTGREKIFSK
HVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL
Structural information
Interpro:  IPR004098  IPR014906  IPR036285  IPR039979  

PDB:  		 2DK4
PDBsum:   2DK4
STRING:   ENSP00000367835
Other Databases GeneCards:  PRPF18  Malacards:  PRPF18

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000350 generation of catalytic s
pliceosome for second tra
nsesterification step
 IBA biological process
GO:0071021 U2-type post-spliceosomal
complex
 IBA cellular component
GO:0005682 U5 snRNP
 IBA cellular component
GO:0046540 U4/U6 x U5 tri-snRNP comp
lex
 IBA cellular component
GO:0071048 nuclear retention of unsp
liced pre-mRNA at the sit
e of transcription
 IBA biological process
GO:0005681 spliceosomal complex
 IEA cellular component
GO:0008380 RNA splicing
 IEA biological process
GO:0005681 spliceosomal complex
 IEA cellular component
GO:0006397 mRNA processing
 IEA biological process
GO:0008380 RNA splicing
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 TAS cellular component
GO:0006397 mRNA processing
 TAS biological process
GO:0008380 RNA splicing
 TAS biological process
GO:0005681 spliceosomal complex
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0016607 nuclear speck
 IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03040Spliceosome

Diseases

Expand All | Collapse All
Associated diseases References
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
31037746 Spermatoge
nic defect
s
16 (1 control,
15 cases)
 Male infertility GSE6023 analyzed using GEO2R
 Show abstract