• Gene id: 85569

Gene Summary

• Gene Symbol: GALP   Gene   UCSC   Ensembl
• Gene name: galanin like peptide
• Alternate names: galanin-like peptide, alarin, gal-like peptide,
• Gene location: 19q13.43 (56176007: 56185774)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system

Protein Summary

• Protein general information: Q9UBC7  
  • Name: Galanin like peptide
  • Length: 116  
  • Mass: 12545
  • Tissue specificity: Isoform 2 is found in ganglia of ganglioneuroma and ganglioneuroblastoma, as well as in differentiated tumor cells of neuroblastoma tissues. Not found in undifferentiated neuroblasts. Isoform 2 is found in the skin, in pericytes coveri
• Sequence:

  MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGL
  PYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS

• Structural information:
  • Interpro: IPR008174  IPR039244  
  • Prosite: PS00861
  • STRING: ENSP00000349884
• Other Databases: GeneCards:  GALP  Malacards:  GALP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0042595	behavioral response to starvation	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042595	behavioral response to starvation	IEA	biological process
GO:0032098	regulation of appetite	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray