• Gene id: 8554

Gene Summary

• Gene Symbol: PIAS1   Gene   UCSC   Ensembl
• Aliases: DDXBP1, GBP, GU/RH-II, ZMIZ3
• Gene name: protein inhibitor of activated STAT 1
• Alternate names: E3 SUMO-protein ligase PIAS1, AR interacting protein, DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1, DEAD/H box-binding protein 1, E3 SUMO-protein transferase PIAS1, RNA helicase II-binding protein, gu-binding protein, protein inhibitor of activated STAT pr,
• Gene location: 15q23 (21740792: 21870956)     Exons: 26     NC_000018.10
• Gene summary(Entrez): This gene encodes a member of the protein inhibitor of activated STAT (PIAS) family. PIAS proteins function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. This protein plays a centra
• OMIM: 603566

Protein Summary

• Protein general information: O75925  
  • Name: E3 SUMO protein ligase PIAS1 (EC 2.3.2. ) (DEAD/H box binding protein 1) (E3 SUMO protein transferase PIAS1) (Gu binding protein) (GBP) (Protein inhibitor of activated STAT protein 1) (RNA helicase II binding protein)
  • Length: 651  
  • Mass: 71836
  • Tissue specificity: Expressed in numerous tissues with highest level in testis. {ECO
• Sequence:

  MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMTPADL
  SIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFYDLLDEL
  IKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNT
  KPCSLPGYLPPTKNGVEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
  GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPTWVCP
  VCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKKEVQEVSASYNGVDGCLSSTLEHQVASHHQS
  SNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQ
  DYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
  LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD

• Structural information:
  • Protein Domains: (11..4-)
    (/note="SAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00186-)
    (124..28-)
    (/note="PINIT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00799"-)
  • Interpro: IPR023321  IPR038654  IPR003034  IPR036361  IPR004181   IPR013083  
  • Prosite: PS51466 PS50800 PS51044
  • PDB: 1V66
  • PDBsum: 1V66
  • DIP: 5970
  • STRING: ENSP00000249636
• Other Databases: GeneCards:  PIAS1  Malacards:  PIAS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016925	protein sumoylation	IEA	biological process
GO:0033235	positive regulation of protein sumoylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0061665	SUMO ligase activity	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IBA	molecular function
GO:0016925	protein sumoylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0007259	receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0019789	SUMO transferase activity	EXP	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0060334	regulation of interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0033235	positive regulation of protein sumoylation	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0051152	positive regulation of smooth muscle cell differentiation	IEA	biological process
GO:0065004	protein-DNA complex assembly	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008542	visual learning	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008134	transcription factor binding	IEA	molecular function
GO:0016605	PML body	IEA	cellular component
GO:0016925	protein sumoylation	IEA	biological process
GO:0061665	SUMO ligase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016925	protein sumoylation	IDA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0033235	positive regulation of protein sumoylation	IDA	biological process
GO:0042127	regulation of cell population proliferation	ISS	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016925	protein sumoylation	ISS	biological process
GO:0016605	PML body	ISS	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis
hsa04630	JAK-STAT signaling pathway
hsa05160	Hepatitis C

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R